BLASTX nr result
ID: Aconitum23_contig00036780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00036780 (399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 emb|CBI30945.3| unnamed protein product [Vitis vinifera] 117 3e-24 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 117 3e-24 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 115 1e-23 ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sin... 114 3e-23 ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_002531431.1| pentatricopeptide repeat-containing protein,... 114 4e-23 ref|XP_008439592.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_008371634.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_011658305.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_011013799.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 109 7e-22 emb|CDP05409.1| unnamed protein product [Coffea canephora] 109 9e-22 ref|XP_002316718.1| pentatricopeptide repeat-containing family p... 109 9e-22 ref|XP_004293531.2| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_010689581.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_009360940.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 >ref|XP_002272135.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Vitis vinifera] Length = 827 Score = 117 bits (293), Expect = 3e-24 Identities = 57/78 (73%), Positives = 65/78 (83%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DANTCH+L+E YL+KG P SY V CRMF+RNLIPDL LC+KVSK L L GKS Sbjct: 744 LRTASKIDANTCHMLIESYLSKGIPLMSYNVACRMFNRNLIPDLKLCEKVSKKLMLEGKS 803 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA KL+LRFVERG +SP Sbjct: 804 EEADKLILRFVERGRISP 821 >emb|CBI30945.3| unnamed protein product [Vitis vinifera] Length = 796 Score = 117 bits (293), Expect = 3e-24 Identities = 57/78 (73%), Positives = 65/78 (83%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DANTCH+L+E YL+KG P SY V CRMF+RNLIPDL LC+KVSK L L GKS Sbjct: 713 LRTASKIDANTCHMLIESYLSKGIPLMSYNVACRMFNRNLIPDLKLCEKVSKKLMLEGKS 772 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA KL+LRFVERG +SP Sbjct: 773 EEADKLILRFVERGRISP 790 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 117 bits (293), Expect = 3e-24 Identities = 57/78 (73%), Positives = 65/78 (83%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DANTCH+L+E YL+KG P SY V CRMF+RNLIPDL LC+KVSK L L GKS Sbjct: 650 LRTASKIDANTCHMLIESYLSKGIPLMSYNVACRMFNRNLIPDLKLCEKVSKKLMLEGKS 709 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA KL+LRFVERG +SP Sbjct: 710 EEADKLILRFVERGRISP 727 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 115 bits (289), Expect = 1e-23 Identities = 57/78 (73%), Positives = 64/78 (82%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DA+TCHVLME YLNKG P +YKV CRMF+RNLIPDL LCKKVS+ L L GKS Sbjct: 752 LRTASKADASTCHVLMESYLNKGIPLLAYKVACRMFNRNLIPDLKLCKKVSERLILEGKS 811 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA L+LRFVERG + P Sbjct: 812 EEADTLMLRFVERGHIQP 829 >ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795643|ref|XP_012092558.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795647|ref|XP_012092559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|643702015|gb|KDP20455.1| hypothetical protein JCGZ_05300 [Jatropha curcas] Length = 833 Score = 114 bits (285), Expect = 3e-23 Identities = 57/78 (73%), Positives = 64/78 (82%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DANTCHVLME YL+KG P +Y+V CRMF+RNLIPDL LC+KVSK L L GKS Sbjct: 748 LRTASRIDANTCHVLMEGYLSKGIPLPAYRVACRMFNRNLIPDLKLCEKVSKKLLLEGKS 807 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA KL LRFVERG SP Sbjct: 808 EEADKLSLRFVERGNTSP 825 >gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sinensis] Length = 701 Score = 114 bits (285), Expect = 3e-23 Identities = 56/78 (71%), Positives = 64/78 (82%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DA+TCHVL+E YLNKG P +YKV CRMF+RNLIPDL LCKKVS+ L L GKS Sbjct: 609 LRTASKADASTCHVLVESYLNKGIPLLAYKVACRMFNRNLIPDLKLCKKVSERLILEGKS 668 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA L+LRFVERG + P Sbjct: 669 EEADTLMLRFVERGHIQP 686 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 114 bits (285), Expect = 3e-23 Identities = 56/78 (71%), Positives = 64/78 (82%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTASK DA+TCHVL+E YLNKG P +YKV CRMF+RNLIPDL LCKKVS+ L L GKS Sbjct: 752 LRTASKADASTCHVLVESYLNKGIPLLAYKVACRMFNRNLIPDLKLCKKVSERLILEGKS 811 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA L+LRFVERG + P Sbjct: 812 EEADTLMLRFVERGHIQP 829 >ref|XP_002531431.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528950|gb|EEF30943.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 737 Score = 114 bits (284), Expect = 4e-23 Identities = 54/78 (69%), Positives = 65/78 (83%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DANTCH+LME YL+KG P S+YKV CRMFDRNLIPDL LC+K+SK L L GK Sbjct: 652 LRTASRIDANTCHMLMESYLSKGIPLSAYKVACRMFDRNLIPDLKLCEKLSKKLVLEGKL 711 Query: 219 KEAKKLLLRFVERGLLSP 166 +EA L+L+FV+RG +SP Sbjct: 712 EEADNLMLQFVQRGNISP 729 >ref|XP_008439592.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Cucumis melo] Length = 847 Score = 112 bits (279), Expect = 1e-22 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCHVLME YLN G P S+YKV CRMF+RNLIPDL LC+KVSK L L GK Sbjct: 762 LRTASRTDAKTCHVLMESYLNVGIPMSAYKVACRMFNRNLIPDLKLCEKVSKRLVLEGKL 821 Query: 219 KEAKKLLLRFVERGLLS 169 +EA +L+LRFVERG +S Sbjct: 822 EEADRLVLRFVERGHVS 838 >ref|XP_008371634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Malus domestica] Length = 843 Score = 110 bits (276), Expect = 3e-22 Identities = 54/77 (70%), Positives = 62/77 (80%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCH LM YL KGDP S+YKV CRMF+RNLIPDL LC+KV+K L L+G S Sbjct: 758 LRTASRVDAKTCHSLMGGYLRKGDPLSAYKVACRMFNRNLIPDLKLCEKVTKRLMLDGNS 817 Query: 219 KEAKKLLLRFVERGLLS 169 KEA L+LRFVERG +S Sbjct: 818 KEADNLMLRFVERGCIS 834 >ref|XP_011658305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Cucumis sativus] gi|700194221|gb|KGN49425.1| hypothetical protein Csa_6G524630 [Cucumis sativus] Length = 847 Score = 110 bits (276), Expect = 3e-22 Identities = 54/77 (70%), Positives = 63/77 (81%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCHVLME YLN G P S+YKV CRMF+RNLIPDL LC+KVSK L + GK Sbjct: 762 LRTASRTDAKTCHVLMESYLNVGIPMSAYKVACRMFNRNLIPDLKLCEKVSKRLVVEGKL 821 Query: 219 KEAKKLLLRFVERGLLS 169 +EA +L+LRFVERG +S Sbjct: 822 EEADRLVLRFVERGHVS 838 >ref|XP_011013799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Populus euphratica] Length = 812 Score = 110 bits (275), Expect = 4e-22 Identities = 55/79 (69%), Positives = 61/79 (77%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DANTCHVLME YL KG P S+YKV CRMF R LIPDL LC+KV K L GKS Sbjct: 726 LRTASRIDANTCHVLMESYLRKGIPLSAYKVACRMFSRGLIPDLKLCEKVCKKLMQEGKS 785 Query: 219 KEAKKLLLRFVERGLLSPY 163 +EA LLLRFVERG +S + Sbjct: 786 EEADNLLLRFVERGNISSH 804 >ref|XP_010275050.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061056|ref|XP_010275051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061060|ref|XP_010275052.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] gi|720061063|ref|XP_010275053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Nelumbo nucifera] Length = 824 Score = 110 bits (275), Expect = 4e-22 Identities = 54/78 (69%), Positives = 61/78 (78%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCH+LME YL KG P SYKV CRMF+RNLIPDL LCKKV + L G S Sbjct: 744 LRTASRIDAGTCHMLMESYLEKGTPLLSYKVACRMFNRNLIPDLKLCKKVRERLISEGNS 803 Query: 219 KEAKKLLLRFVERGLLSP 166 KEA +L++ FVERGLLSP Sbjct: 804 KEADRLMILFVERGLLSP 821 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 109 bits (273), Expect = 7e-22 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTA++ DA TCHVLM+ YL KG P S+YKV CRMF+RNLIPDL LC+KV+K L G S Sbjct: 717 LRTAARVDAKTCHVLMDSYLRKGTPLSAYKVACRMFNRNLIPDLKLCEKVTKRLMSEGNS 776 Query: 219 KEAKKLLLRFVERGLLS 169 KEA L+LRFVERG LS Sbjct: 777 KEADNLMLRFVERGCLS 793 >emb|CDP05409.1| unnamed protein product [Coffea canephora] Length = 830 Score = 109 bits (272), Expect = 9e-22 Identities = 53/78 (67%), Positives = 62/78 (79%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS DA TC++L+E YL KGD SSYKV C+MF RNLIPDL LC+KVSK L L GK+ Sbjct: 750 LRTASNIDARTCNILLESYLKKGDSLSSYKVACQMFKRNLIPDLKLCEKVSKRLLLEGKT 809 Query: 219 KEAKKLLLRFVERGLLSP 166 EA KL+L+FVERG +SP Sbjct: 810 DEADKLMLQFVERGCISP 827 >ref|XP_002316718.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222859783|gb|EEE97330.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 684 Score = 109 bits (272), Expect = 9e-22 Identities = 54/79 (68%), Positives = 61/79 (77%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DANTCHVLME YL KG P S+YKV CRMF R+LIPDL LC+KV K L GKS Sbjct: 598 LRTASRIDANTCHVLMESYLRKGIPLSAYKVACRMFSRSLIPDLKLCEKVCKKLMQEGKS 657 Query: 219 KEAKKLLLRFVERGLLSPY 163 +EA L LRFVERG +S + Sbjct: 658 EEADNLFLRFVERGNISSH 676 >ref|XP_004293531.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Fragaria vesca subsp. vesca] Length = 812 Score = 108 bits (271), Expect = 1e-21 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCHV+M+ YL KG P S+YKV CRMF RNLIPDL LC+KV K L L+G S Sbjct: 727 LRTASRVDAKTCHVVMDGYLRKGIPLSAYKVACRMFSRNLIPDLKLCEKVIKKLMLSGNS 786 Query: 219 KEAKKLLLRFVERGLLS 169 KEA L+LRFVERG +S Sbjct: 787 KEADNLMLRFVERGCIS 803 >ref|XP_010689581.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|731356267|ref|XP_010689582.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|731356269|ref|XP_010689583.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|731356271|ref|XP_010689584.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|731356273|ref|XP_010689585.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|731356275|ref|XP_010689587.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Beta vulgaris subsp. vulgaris] gi|870849912|gb|KMT02097.1| hypothetical protein BVRB_9g208250 [Beta vulgaris subsp. vulgaris] Length = 825 Score = 108 bits (271), Expect = 1e-21 Identities = 52/78 (66%), Positives = 62/78 (79%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LR+AS+ DA+TCHVLM+ YLN G P +YKV CRMF RNL PDL LCKKVSK L L+G Sbjct: 747 LRSASRIDAHTCHVLMQSYLNIGSPLLAYKVACRMFRRNLTPDLKLCKKVSKKLTLDGNI 806 Query: 219 KEAKKLLLRFVERGLLSP 166 KEA L+++FVERGL+SP Sbjct: 807 KEADSLIIQFVERGLVSP 824 >ref|XP_009360940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial [Pyrus x bretschneideri] Length = 846 Score = 108 bits (271), Expect = 1e-21 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 LRTAS+ DA TCH LM YL GDP S+YKV CRMF+RNLIPDL LC+KV+K L L+G S Sbjct: 761 LRTASRVDAKTCHSLMGGYLRNGDPLSAYKVACRMFNRNLIPDLKLCEKVTKRLMLDGNS 820 Query: 219 KEAKKLLLRFVERGLLS 169 KEA L+LRFVERG +S Sbjct: 821 KEADNLMLRFVERGCIS 837 >ref|XP_012453778.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242162|ref|XP_012453779.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242164|ref|XP_012453780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242166|ref|XP_012453781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242168|ref|XP_012453782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242170|ref|XP_012453783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] gi|823242172|ref|XP_012453784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Gossypium raimondii] Length = 807 Score = 108 bits (270), Expect = 2e-21 Identities = 53/78 (67%), Positives = 64/78 (82%) Frame = -1 Query: 399 LRTASKNDANTCHVLMECYLNKGDPFSSYKVGCRMFDRNLIPDLNLCKKVSKSLGLNGKS 220 L+TAS+NDANTC++L+E YL+KG P S+YKV CRMF+RNLIP+L L K+SK L L GKS Sbjct: 727 LKTASRNDANTCNMLLESYLSKGMPLSAYKVACRMFNRNLIPNLKLSDKLSKRLMLEGKS 786 Query: 219 KEAKKLLLRFVERGLLSP 166 EA L+LRFVERG LSP Sbjct: 787 AEADNLMLRFVERGHLSP 804