BLASTX nr result
ID: Aconitum23_contig00035900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035900 (586 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II tra... 57 9e-06 >ref|XP_010244438.1| PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like [Nelumbo nucifera] Length = 1410 Score = 56.6 bits (135), Expect = 9e-06 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 4/77 (5%) Frame = -3 Query: 503 RSNFVSTLQTSSGLQAINGNPISSLQQGSVGSLEKININAAQRGQFNVPSQNDMNGLQPK 324 R N +++LQ+SS L++ GN SSLQQG+ GSL++ ++ +Q+ + S +N LQP Sbjct: 791 RPNVMNSLQSSSNLESGQGNASSSLQQGAAGSLQESTVSMSQQSNISTLSHGSVNALQPN 850 Query: 323 TTP----SRALHPQHLK 285 P + L QHLK Sbjct: 851 IGPIQPNANMLQQQHLK 867