BLASTX nr result
ID: Aconitum23_contig00035858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035858 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464112.1| hypothetical protein SORBIDRAFT_01g012530 [S... 65 4e-11 ref|XP_008794577.1| PREDICTED: 11S globulin seed storage protein... 71 6e-11 ref|XP_010920723.1| PREDICTED: 11S globulin seed storage protein... 70 6e-11 ref|XP_009380668.1| PREDICTED: 11S globulin seed storage protein... 68 4e-10 ref|NP_001266582.1| legumin-like protein [Zea mays] gi|195629806... 67 8e-10 ref|NP_001105062.1| legumin-like protein [Zea mays] gi|28950668|... 67 8e-10 ref|XP_012703909.1| PREDICTED: 11S globulin seed storage protein... 64 8e-10 ref|XP_006294419.1| hypothetical protein CARUB_v10023441mg, part... 60 1e-09 ref|XP_002440480.1| hypothetical protein SORBIDRAFT_09g001680 [S... 67 1e-09 ref|XP_011659088.1| PREDICTED: 11S globulin seed storage protein... 63 1e-09 ref|XP_008461502.1| PREDICTED: glutelin type-A 1-like [Cucumis m... 63 2e-09 gb|ACG36012.1| legumin-like protein [Zea mays] 65 3e-09 ref|XP_012064964.1| PREDICTED: 12S seed storage globulin 1 [Jatr... 61 3e-09 ref|NP_172255.1| cupin domain-containing protein [Arabidopsis th... 62 3e-09 gb|AAM65577.1| globulin-like protein [Arabidopsis thaliana] 62 3e-09 ref|XP_004150394.1| PREDICTED: glutelin type-B 5-like isoform X1... 62 3e-09 gb|KDP44182.1| hypothetical protein JCGZ_05649 [Jatropha curcas] 61 3e-09 ref|XP_003565190.1| PREDICTED: glutelin type-B 2-like [Brachypod... 62 5e-09 ref|XP_006653975.1| PREDICTED: 11S globulin seed storage protein... 65 5e-09 ref|XP_002892418.1| hypothetical protein ARALYDRAFT_470808 [Arab... 60 5e-09 >ref|XP_002464112.1| hypothetical protein SORBIDRAFT_01g012530 [Sorghum bicolor] gi|241917966|gb|EER91110.1| hypothetical protein SORBIDRAFT_01g012530 [Sorghum bicolor] Length = 375 Score = 64.7 bits (156), Expect(2) = 4e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLL 14 L + GLALP YSDSAKVAYVLQG GT G+V+PEATKEK++ Sbjct: 52 LCLSAGGLALPSYSDSAKVAYVLQGKGTCGVVLPEATKEKVI 93 Score = 29.6 bits (65), Expect(2) = 4e-11 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 210 TRNIKGLDES*TLPNNSYGSDGGSY 136 T + +D S PN +YGSDGG+Y Sbjct: 7 TAQVMSMDLSPKKPNKAYGSDGGAY 31 >ref|XP_008794577.1| PREDICTED: 11S globulin seed storage protein 2-like [Phoenix dactylifera] Length = 357 Score = 70.9 bits (172), Expect(2) = 6e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLL 14 L ++K GLALP YSDSAKVAYVLQGSGT GIV+PEATKEK+L Sbjct: 42 LALEKQGLALPSYSDSAKVAYVLQGSGTCGIVLPEATKEKVL 83 Score = 22.7 bits (47), Expect(2) = 6e-11 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D + L +YG DGGSY Sbjct: 3 IDLTPRLSKKTYGGDGGSY 21 >ref|XP_010920723.1| PREDICTED: 11S globulin seed storage protein 2-like [Elaeis guineensis] Length = 357 Score = 69.7 bits (169), Expect(2) = 6e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLL 14 L ++K GLALP YSDSAKVAYVLQG+GT GIV+PEATKEK+L Sbjct: 42 LALEKQGLALPSYSDSAKVAYVLQGNGTCGIVLPEATKEKVL 83 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D S L +YG DGGSY Sbjct: 3 IDLSPRLSKKTYGGDGGSY 21 >ref|XP_009380668.1| PREDICTED: 11S globulin seed storage protein 2-like [Musa acuminata subsp. malaccensis] Length = 357 Score = 68.2 bits (165), Expect(2) = 4e-10 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++K+GLALP YSDS+KVAYVLQG GT GIV+PEATKEK++A Sbjct: 42 LALEKSGLALPFYSDSSKVAYVLQGGGTCGIVLPEATKEKVIA 84 Score = 22.7 bits (47), Expect(2) = 4e-10 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D + L SYG DGG+Y Sbjct: 3 IDLTPKLSKKSYGGDGGAY 21 >ref|NP_001266582.1| legumin-like protein [Zea mays] gi|195629806|gb|ACG36544.1| legumin-like protein [Zea mays] Length = 360 Score = 67.0 bits (162), Expect(2) = 8e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L + GLALP YSDSAKVAYVLQG+GT GIV+PEATKEK++A Sbjct: 43 LSLAAGGLALPSYSDSAKVAYVLQGTGTCGIVLPEATKEKVVA 85 Score = 22.7 bits (47), Expect(2) = 8e-10 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 171 PNNSYGSDGGSY 136 P +YG DGG+Y Sbjct: 11 PRKAYGGDGGAY 22 >ref|NP_001105062.1| legumin-like protein [Zea mays] gi|28950668|gb|AAO63266.1| legumin-like protein [Zea mays] gi|413950180|gb|AFW82829.1| putative rmlC-like cupins superfamily protein [Zea mays] Length = 360 Score = 67.0 bits (162), Expect(2) = 8e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L + GLALP YSDSAKVAYVLQG+GT GIV+PEATKEK++A Sbjct: 43 LSLAAGGLALPSYSDSAKVAYVLQGTGTCGIVLPEATKEKVVA 85 Score = 22.7 bits (47), Expect(2) = 8e-10 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 171 PNNSYGSDGGSY 136 P +YG DGG+Y Sbjct: 11 PRKAYGGDGGAY 22 >ref|XP_012703909.1| PREDICTED: 11S globulin seed storage protein 2-like [Setaria italica] Length = 360 Score = 63.9 bits (154), Expect(2) = 8e-10 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLL 14 + + GLALP YSDSAK+AYVLQG GT G+V+PEATKEK++ Sbjct: 42 MSLAAGGLALPSYSDSAKIAYVLQGKGTCGVVLPEATKEKVI 83 Score = 25.8 bits (55), Expect(2) = 8e-10 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D S PN +YG DGG+Y Sbjct: 3 MDLSPKKPNKAYGGDGGAY 21 >ref|XP_006294419.1| hypothetical protein CARUB_v10023441mg, partial [Capsella rubella] gi|482563127|gb|EOA27317.1| hypothetical protein CARUB_v10023441mg, partial [Capsella rubella] Length = 377 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++K GLALP+YSDS KVAYVLQG+GTAGIV+PE +EK++A Sbjct: 63 LALEKYGLALPRYSDSPKVAYVLQGAGTAGIVLPE-KEEKVIA 104 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -2 Query: 264 SSSFQAACLLH*NGKCQFTRNIKGLDES*TLPNNSYGSDGGSY 136 S SF A L N C T + LD S LP YG DGGSY Sbjct: 3 SQSFLFALSLPSNFFCALTMD---LDLSPRLPKKVYGGDGGSY 42 >ref|XP_002440480.1| hypothetical protein SORBIDRAFT_09g001680 [Sorghum bicolor] gi|241945765|gb|EES18910.1| hypothetical protein SORBIDRAFT_09g001680 [Sorghum bicolor] Length = 360 Score = 67.0 bits (162), Expect(2) = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L + GLALP YSDSAKVAYVLQG+GT GIV+PEATKEK++A Sbjct: 43 LSLAAGGLALPSYSDSAKVAYVLQGTGTCGIVLPEATKEKVVA 85 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 171 PNNSYGSDGGSY 136 P +YG +GGSY Sbjct: 11 PRKAYGGEGGSY 22 >ref|XP_011659088.1| PREDICTED: 11S globulin seed storage protein 2-like isoform X2 [Cucumis sativus] Length = 356 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG ALP+YSDSAKVAYVLQGSG AGI++PE ++EK++A Sbjct: 42 LALEKNGFALPRYSDSAKVAYVLQGSGVAGIILPE-SEEKVIA 83 Score = 26.2 bits (56), Expect(2) = 1e-09 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D + LP YGSDGGSY Sbjct: 3 IDLTPQLPKKIYGSDGGSY 21 >ref|XP_008461502.1| PREDICTED: glutelin type-A 1-like [Cucumis melo] Length = 356 Score = 62.8 bits (151), Expect(2) = 2e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG ALP+YSDSAKVAYVLQGSG AGI++PE ++EK++A Sbjct: 42 LALEKNGFALPRYSDSAKVAYVLQGSGVAGIILPE-SEEKVIA 83 Score = 25.8 bits (55), Expect(2) = 2e-09 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSYQS 130 +D + LP YG DGGSY S Sbjct: 3 IDLTPQLPKKIYGGDGGSYYS 23 >gb|ACG36012.1| legumin-like protein [Zea mays] Length = 363 Score = 65.1 bits (157), Expect(2) = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L + GL+LP YSDSAKVAYVLQG+GT G+V+PEATKEK++A Sbjct: 43 LSLAAGGLSLPSYSDSAKVAYVLQGAGTCGLVLPEATKEKVVA 85 Score = 22.7 bits (47), Expect(2) = 3e-09 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 171 PNNSYGSDGGSY 136 P +YG DGG+Y Sbjct: 11 PKKAYGGDGGAY 22 >ref|XP_012064964.1| PREDICTED: 12S seed storage globulin 1 [Jatropha curcas] Length = 358 Score = 61.2 bits (147), Expect(2) = 3e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG ALP+YSDSAKVAYVLQG+G AGIV+PE +EK++A Sbjct: 44 LALEKNGFALPRYSDSAKVAYVLQGTGVAGIVLPE-KEEKVIA 85 Score = 26.6 bits (57), Expect(2) = 3e-09 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 LD S LP YG DGGSY Sbjct: 5 LDLSPRLPKKVYGGDGGSY 23 >ref|NP_172255.1| cupin domain-containing protein [Arabidopsis thaliana] gi|8439891|gb|AAF75077.1|AC007583_13 Contains similarity to 12S seed storage globulin precursor gi|134919. ESTs gb|T13642, gb|T21684 and gb|T22751 come from this gene [Arabidopsis thaliana] gi|12248029|gb|AAG50106.1|AF334728_1 putative globulin protein [Arabidopsis thaliana] gi|15294234|gb|AAK95294.1|AF410308_1 At1g07750/F24B9_13 [Arabidopsis thaliana] gi|24111337|gb|AAN46792.1| At1g07750/F24B9_13 [Arabidopsis thaliana] gi|332190055|gb|AEE28176.1| cupin domain-containing protein [Arabidopsis thaliana] Length = 356 Score = 62.0 bits (149), Expect(2) = 3e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG A+P+YSDS+KVAYVLQGSGTAGIV+PE +EK++A Sbjct: 42 LALEKNGFAVPRYSDSSKVAYVLQGSGTAGIVLPE-KEEKVIA 83 Score = 25.8 bits (55), Expect(2) = 3e-09 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSYQS 130 LD + LP YG DGGSY + Sbjct: 3 LDLTPKLPKKVYGGDGGSYSA 23 >gb|AAM65577.1| globulin-like protein [Arabidopsis thaliana] Length = 356 Score = 62.0 bits (149), Expect(2) = 3e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG A+P+YSDS+KVAYVLQGSGTAGIV+PE +EK++A Sbjct: 42 LALEKNGFAVPRYSDSSKVAYVLQGSGTAGIVLPE-KEEKVIA 83 Score = 25.8 bits (55), Expect(2) = 3e-09 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSYQS 130 LD + LP YG DGGSY + Sbjct: 3 LDLTPKLPKKVYGGDGGSYSA 23 >ref|XP_004150394.1| PREDICTED: glutelin type-B 5-like isoform X1 [Cucumis sativus] gi|700189176|gb|KGN44409.1| hypothetical protein Csa_7G281380 [Cucumis sativus] Length = 356 Score = 61.6 bits (148), Expect(2) = 3e-09 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG ALP+YSDSAKVAYVLQG+G AGI++PE ++EK++A Sbjct: 42 LALEKNGFALPRYSDSAKVAYVLQGNGVAGIILPE-SEEKVIA 83 Score = 26.2 bits (56), Expect(2) = 3e-09 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 +D + LP YGSDGGSY Sbjct: 3 IDLTPQLPKKIYGSDGGSY 21 >gb|KDP44182.1| hypothetical protein JCGZ_05649 [Jatropha curcas] Length = 356 Score = 61.2 bits (147), Expect(2) = 3e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++KNG ALP+YSDSAKVAYVLQG+G AGIV+PE +EK++A Sbjct: 42 LALEKNGFALPRYSDSAKVAYVLQGTGVAGIVLPE-KEEKVIA 83 Score = 26.6 bits (57), Expect(2) = 3e-09 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 LD S LP YG DGGSY Sbjct: 3 LDLSPRLPKKVYGGDGGSY 21 >ref|XP_003565190.1| PREDICTED: glutelin type-B 2-like [Brachypodium distachyon] gi|944076336|gb|KQK11820.1| hypothetical protein BRADI_2g62587 [Brachypodium distachyon] Length = 370 Score = 62.4 bits (150), Expect(2) = 5e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLL 14 L + GL+LP YSDSAKVAYVLQGSGT G+V+PEAT EK++ Sbjct: 52 LHLAAGGLSLPSYSDSAKVAYVLQGSGTIGVVLPEATAEKVI 93 Score = 24.6 bits (52), Expect(2) = 5e-09 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 201 IKGLDES*TLPNNSYGSDGGSY 136 + +D S P SYG DGG+Y Sbjct: 10 VMSMDLSPKKPAKSYGGDGGAY 31 >ref|XP_006653975.1| PREDICTED: 11S globulin seed storage protein 2-like [Oryza brachyantha] Length = 359 Score = 64.7 bits (156), Expect(2) = 5e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L + GL+LP YSDSAKVAYVLQG GT GIV+PEATKEK++A Sbjct: 43 LCLAAGGLSLPSYSDSAKVAYVLQGKGTCGIVLPEATKEKVVA 85 Score = 22.3 bits (46), Expect(2) = 5e-09 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 195 GLDES*TLPNNSYGSDGGSY 136 G+D + P +YG +GG+Y Sbjct: 3 GVDLTPRPPRKAYGGEGGAY 22 >ref|XP_002892418.1| hypothetical protein ARALYDRAFT_470808 [Arabidopsis lyrata subsp. lyrata] gi|297338260|gb|EFH68677.1| hypothetical protein ARALYDRAFT_470808 [Arabidopsis lyrata subsp. lyrata] Length = 356 Score = 60.5 bits (145), Expect(2) = 5e-09 Identities = 29/43 (67%), Positives = 39/43 (90%) Frame = -1 Query: 139 LPIKKNGLALPQYSDSAKVAYVLQGSGTAGIVIPEATKEKLLA 11 L ++K+G A+P+YSDS+KVAYVLQGSGTAGIV+PE +EK++A Sbjct: 42 LALEKHGFAIPRYSDSSKVAYVLQGSGTAGIVLPE-QEEKVIA 83 Score = 26.6 bits (57), Expect(2) = 5e-09 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 192 LDES*TLPNNSYGSDGGSY 136 LD S LP YG DGGSY Sbjct: 3 LDLSPKLPKKVYGGDGGSY 21