BLASTX nr result
ID: Aconitum23_contig00035683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035683 (495 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Popu... 58 2e-06 ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] gi|550350020|gb|EEE85358.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] Length = 1112 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 159 ESGKGLVESARLIEKQFEFEPSFDEYLKAMESVKTGRERRPAVRDDS 19 ES LV S +IEK+FEF+PSF EYLKAMESVKTGRE+ + +S Sbjct: 15 ESDNRLVGSGGVIEKEFEFKPSFGEYLKAMESVKTGREKNQVHKSNS 61 >ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Populus euphratica] Length = 1025 Score = 57.8 bits (138), Expect = 3e-06 Identities = 41/114 (35%), Positives = 55/114 (48%), Gaps = 18/114 (15%) Frame = -1 Query: 306 LIMANGQMGASTYSLKPSLL-----QPFGKIGA-----NPISRIASERKKNRIFSGVGA- 160 +IM NGQ G S + +L +P+ G PI + + + VG Sbjct: 4 IIMTNGQNGLSGFERNGNLTCNCSWKPYSSCGPLNSWRPPIVGVPLKSMHGKAMRFVGLR 63 Query: 159 -------ESGKGLVESARLIEKQFEFEPSFDEYLKAMESVKTGRERRPAVRDDS 19 ES LV +IEK+ EF+PSF EYLKAMESVKTGRE+ + +S Sbjct: 64 VRALQKDESDNRLVGGGGVIEKELEFKPSFGEYLKAMESVKTGREKNQVHKSNS 117 >ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] gi|743922503|ref|XP_011005324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] Length = 1142 Score = 57.8 bits (138), Expect = 3e-06 Identities = 41/114 (35%), Positives = 55/114 (48%), Gaps = 18/114 (15%) Frame = -1 Query: 306 LIMANGQMGASTYSLKPSLL-----QPFGKIGA-----NPISRIASERKKNRIFSGVGA- 160 +IM NGQ G S + +L +P+ G PI + + + VG Sbjct: 4 IIMTNGQNGLSGFERNGNLTCNCSWKPYSSCGPLNSWRPPIVGVPLKSMHGKAMRFVGLR 63 Query: 159 -------ESGKGLVESARLIEKQFEFEPSFDEYLKAMESVKTGRERRPAVRDDS 19 ES LV +IEK+ EF+PSF EYLKAMESVKTGRE+ + +S Sbjct: 64 VRALQKDESDNRLVGGGGVIEKELEFKPSFGEYLKAMESVKTGREKNQVHKSNS 117