BLASTX nr result
ID: Aconitum23_contig00035596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035596 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] 57 4e-06 >emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] Length = 114 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 333 T*AFIVMERLNSKLLLQNCYIIQENERLRRKA 238 T FIVMERLNSKL LQNCYIIQENERLR+KA Sbjct: 32 TTVFIVMERLNSKLYLQNCYIIQENERLRKKA 63