BLASTX nr result
ID: Aconitum23_contig00035500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035500 (395 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar ... 86 8e-15 ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar ... 85 2e-14 gb|KRH44487.1| hypothetical protein GLYMA_08G214300 [Glycine max] 84 4e-14 ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane pr... 84 4e-14 ref|XP_012449781.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton ... 84 4e-14 gb|KHN01313.1| Pyrophosphate-energized vacuolar membrane proton ... 84 4e-14 ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina] 84 4e-14 emb|CDO98179.1| unnamed protein product [Coffea canephora] 84 4e-14 ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 ref|XP_008389636.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphat... 84 4e-14 ref|XP_012073123.1| PREDICTED: pyrophosphate-energized vacuolar ... 84 4e-14 >ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Malus domestica] Length = 1179 Score = 86.3 bits (212), Expect = 8e-15 Identities = 48/72 (66%), Positives = 52/72 (72%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFFTRETDSRGNL 181 RTLG KGS+ HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF G L Sbjct: 707 RTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATH---GGLL 763 Query: 182 ICIVGVPILTPP 217 I G+ +PP Sbjct: 764 FKIFGICTASPP 775 >ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Nelumbo nucifera] Length = 765 Score = 84.7 bits (208), Expect = 2e-14 Identities = 43/52 (82%), Positives = 45/52 (86%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFFTR 157 RTLG KGS+ HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF R Sbjct: 705 RTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFAR 756 >gb|KRH44487.1| hypothetical protein GLYMA_08G214300 [Glycine max] Length = 667 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 607 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 656 >ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] gi|587878246|gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 765 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754 >ref|XP_012449781.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Gossypium raimondii] gi|763797700|gb|KJB64655.1| hypothetical protein B456_010G059800 [Gossypium raimondii] Length = 766 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 706 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 755 >ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Sesamum indicum] Length = 764 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754 >ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Elaeis guineensis] Length = 767 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 707 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 756 >gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine soja] Length = 764 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 704 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 753 >gb|KHN01313.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine soja] Length = 667 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 607 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 656 >ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Nelumbo nucifera] Length = 765 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754 >ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Nicotiana sylvestris] Length = 769 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 709 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 758 >ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Nicotiana tomentosiformis] Length = 769 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 709 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 758 >ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Pyrus x bretschneideri] Length = 764 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSECHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754 >ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Pyrus x bretschneideri] Length = 767 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 708 RTLGPKGSECHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 757 >gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina] Length = 769 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 708 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 757 >emb|CDO98179.1| unnamed protein product [Coffea canephora] Length = 762 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 703 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 752 >ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Malus domestica] Length = 767 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 708 RTLGPKGSECHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 757 >ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Malus domestica] Length = 764 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSECHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754 >ref|XP_008389636.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar membrane proton pump-like, partial [Malus domestica] Length = 685 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 626 RTLGPKGSECHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 675 >ref|XP_012073123.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Jatropha curcas] gi|643729167|gb|KDP37047.1| hypothetical protein JCGZ_06103 [Jatropha curcas] Length = 765 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = +2 Query: 2 RTLGQKGSESHKAAVISDTIGDPLKDTSGPSLSILINPMAVESLVFAHFF 151 RTLG KGSE HKAAVI DTIGDPLKDTSGPSL+ILI MAVESLVFA FF Sbjct: 705 RTLGPKGSEPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFF 754