BLASTX nr result
ID: Aconitum23_contig00035233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00035233 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010112113.1| hypothetical protein L484_019851 [Morus nota... 62 2e-07 >ref|XP_010112113.1| hypothetical protein L484_019851 [Morus notabilis] gi|587946399|gb|EXC32738.1| hypothetical protein L484_019851 [Morus notabilis] Length = 2792 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 4/100 (4%) Frame = -1 Query: 289 INRQEKSLEASTGS--YGTKSNSCSKTSSIDLNHLVNIIQGLDDEEVRHLFKMRSLTSKP 116 ++ EK +E + S G ++ C SSI L L+++ +GL +E+ L K R L S Sbjct: 358 LDNDEKPMETNLASSAIGLITSPCPDLSSISLPQLIDLFRGLSEEKYVLLLKSRDLVSSR 417 Query: 115 K--SENVVIPEQGLGDVIESLKQQLYFTIVAKDFFQLQLS 2 + + N+ IP+ G ++E LK++L+ T KD FQLQL+ Sbjct: 418 ELGANNLTIPDNGTRHLLERLKEELFLTNFTKDIFQLQLA 457