BLASTX nr result
ID: Aconitum23_contig00033215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00033215 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98251.1| unnamed protein product [Coffea canephora] 56 9e-06 >emb|CDO98251.1| unnamed protein product [Coffea canephora] Length = 470 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 441 GIIGNYQQKNQRVVYDTKNYKLGFAKEICGF 349 GIIGNYQQKN RV+YDTK KLGFAKE C F Sbjct: 439 GIIGNYQQKNTRVIYDTKESKLGFAKESCSF 469