BLASTX nr result
ID: Aconitum23_contig00033063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00033063 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534600.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 >ref|XP_002534600.1| conserved hypothetical protein [Ricinus communis] gi|223524952|gb|EEF27787.1| conserved hypothetical protein [Ricinus communis] Length = 199 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 336 KKYQIRLYGKSCCEEWFVMMLYIILHWGMK*SPARAPTRLT 214 ++YQIRLYGKS CEE FVM+ YIILHWGMK SP RAPTRLT Sbjct: 159 QQYQIRLYGKSRCEERFVMVFYIILHWGMKRSPTRAPTRLT 199