BLASTX nr result
ID: Aconitum23_contig00032277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00032277 (803 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013462210.1| abscisic acid-responsive (TB2/DP1, HVA22) fa... 60 1e-06 ref|XP_003603748.1| abscisic acid-responsive (TB2/DP1, HVA22) fa... 60 1e-06 ref|XP_012073815.1| PREDICTED: putative HVA22-like protein g [Ja... 59 4e-06 ref|XP_010539052.1| PREDICTED: HVA22-like protein i [Tarenaya ha... 59 5e-06 ref|XP_010530286.1| PREDICTED: putative HVA22-like protein g [Ta... 59 5e-06 gb|KDO84834.1| hypothetical protein CISIN_1g020811mg [Citrus sin... 59 5e-06 ref|XP_006473645.1| PREDICTED: HVA22-like protein i-like [Citrus... 59 5e-06 ref|XP_006435167.1| hypothetical protein CICLE_v10001859mg [Citr... 59 5e-06 >ref|XP_013462210.1| abscisic acid-responsive (TB2/DP1, HVA22) family protein [Medicago truncatula] gi|657396108|gb|KEH36245.1| abscisic acid-responsive (TB2/DP1, HVA22) family protein [Medicago truncatula] Length = 312 Score = 60.5 bits (145), Expect = 1e-06 Identities = 25/39 (64%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = -2 Query: 115 FFAYEGFTVM-AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 FF+Y+G+ ++ +FVTR L+M+FGY+YPAYECYK VEKN+ Sbjct: 143 FFSYQGYKMIGSFVTRILVMVFGYAYPAYECYKAVEKNR 181 >ref|XP_003603748.1| abscisic acid-responsive (TB2/DP1, HVA22) family protein [Medicago truncatula] gi|355492796|gb|AES73999.1| abscisic acid-responsive (TB2/DP1, HVA22) family protein [Medicago truncatula] Length = 434 Score = 60.5 bits (145), Expect = 1e-06 Identities = 25/39 (64%), Positives = 35/39 (89%), Gaps = 1/39 (2%) Frame = -2 Query: 115 FFAYEGFTVM-AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 FF+Y+G+ ++ +FVTR L+M+FGY+YPAYECYK VEKN+ Sbjct: 143 FFSYQGYKMIGSFVTRILVMVFGYAYPAYECYKAVEKNR 181 >ref|XP_012073815.1| PREDICTED: putative HVA22-like protein g [Jatropha curcas] gi|802607460|ref|XP_012073816.1| PREDICTED: putative HVA22-like protein g [Jatropha curcas] gi|643728999|gb|KDP36936.1| hypothetical protein JCGZ_08227 [Jatropha curcas] Length = 299 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+MIFGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMIFGYAYPAYECYKTVEKNK 31 >ref|XP_010539052.1| PREDICTED: HVA22-like protein i [Tarenaya hassleriana] Length = 305 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+M+FGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMVFGYAYPAYECYKTVEKNK 31 >ref|XP_010530286.1| PREDICTED: putative HVA22-like protein g [Tarenaya hassleriana] Length = 286 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+M+FGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMVFGYAYPAYECYKTVEKNK 31 >gb|KDO84834.1| hypothetical protein CISIN_1g020811mg [Citrus sinensis] gi|641866150|gb|KDO84835.1| hypothetical protein CISIN_1g020811mg [Citrus sinensis] Length = 321 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+M+FGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMVFGYAYPAYECYKTVEKNK 31 >ref|XP_006473645.1| PREDICTED: HVA22-like protein i-like [Citrus sinensis] Length = 321 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+M+FGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMVFGYAYPAYECYKTVEKNK 31 >ref|XP_006435167.1| hypothetical protein CICLE_v10001859mg [Citrus clementina] gi|557537289|gb|ESR48407.1| hypothetical protein CICLE_v10001859mg [Citrus clementina] Length = 321 Score = 58.5 bits (140), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 85 AFVTRGLIMIFGYSYPAYECYKTVEKNK 2 +F+TRGL+M+FGY+YPAYECYKTVEKNK Sbjct: 4 SFLTRGLVMVFGYAYPAYECYKTVEKNK 31