BLASTX nr result
ID: Aconitum23_contig00029906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029906 (327 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL44396.1| calcineurin-like phosphoesterase [Manihot esculenta] 68 2e-09 gb|AFY06665.1| purple acid phosphatase [Citrus trifoliata] 67 5e-09 ref|XP_006483400.1| PREDICTED: bifunctional purple acid phosphat... 67 5e-09 ref|XP_006450381.1| hypothetical protein CICLE_v10008150mg [Citr... 67 5e-09 ref|XP_006450380.1| hypothetical protein CICLE_v10008150mg [Citr... 67 5e-09 gb|KJB64668.1| hypothetical protein B456_010G060100 [Gossypium r... 65 1e-08 gb|KJB64666.1| hypothetical protein B456_010G060100 [Gossypium r... 65 1e-08 ref|XP_012449720.1| PREDICTED: bifunctional purple acid phosphat... 65 1e-08 gb|KJB64662.1| hypothetical protein B456_010G060100 [Gossypium r... 65 1e-08 ref|XP_002515485.1| Iron(III)-zinc(II) purple acid phosphatase p... 65 2e-08 ref|XP_010250242.1| PREDICTED: bifunctional purple acid phosphat... 65 3e-08 ref|XP_010096988.1| Bifunctional purple acid phosphatase 26 [Mor... 64 3e-08 ref|XP_010648745.1| PREDICTED: bifunctional purple acid phosphat... 64 4e-08 gb|KJB83221.1| hypothetical protein B456_013G236000 [Gossypium r... 63 7e-08 ref|XP_012464349.1| PREDICTED: bifunctional purple acid phosphat... 63 7e-08 gb|KHG11290.1| Bifunctional purple acid phosphatase 26 -like pro... 63 7e-08 ref|XP_007013584.1| Purple acid phosphatase 26 isoform 3 [Theobr... 63 7e-08 ref|XP_007013583.1| Purple acid phosphatase 26 isoform 2 [Theobr... 63 7e-08 ref|XP_007013582.1| Purple acid phosphatase 26 isoform 1 [Theobr... 63 7e-08 gb|AET86956.1| PAP26 [Gossypium hirsutum] 63 7e-08 >gb|AGL44396.1| calcineurin-like phosphoesterase [Manihot esculenta] Length = 469 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIG+ DS+ EFWFQ PPKIDPD PYTFG+ G Sbjct: 125 DTKYYYKIGEGDSSREFWFQTPPKIDPDAPYTFGIIG 161 >gb|AFY06665.1| purple acid phosphatase [Citrus trifoliata] Length = 476 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIGD DS+ EFWFQ PPKI PD PYTFG+ G Sbjct: 132 DTKYYYKIGDGDSSREFWFQTPPKIHPDAPYTFGIIG 168 >ref|XP_006483400.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform X1 [Citrus sinensis] Length = 479 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIGD DS+ EFWFQ PPKI PD PYTFG+ G Sbjct: 132 DTKYYYKIGDGDSSREFWFQTPPKIHPDAPYTFGIIG 168 >ref|XP_006450381.1| hypothetical protein CICLE_v10008150mg [Citrus clementina] gi|557553607|gb|ESR63621.1| hypothetical protein CICLE_v10008150mg [Citrus clementina] gi|641842894|gb|KDO61797.1| hypothetical protein CISIN_1g011680mg [Citrus sinensis] Length = 374 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIGD DS+ EFWFQ PPKI PD PYTFG+ G Sbjct: 132 DTKYYYKIGDGDSSREFWFQTPPKIHPDAPYTFGIIG 168 >ref|XP_006450380.1| hypothetical protein CICLE_v10008150mg [Citrus clementina] gi|557553606|gb|ESR63620.1| hypothetical protein CICLE_v10008150mg [Citrus clementina] gi|641842893|gb|KDO61796.1| hypothetical protein CISIN_1g011680mg [Citrus sinensis] Length = 479 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIGD DS+ EFWFQ PPKI PD PYTFG+ G Sbjct: 132 DTKYYYKIGDGDSSREFWFQTPPKIHPDAPYTFGIIG 168 >gb|KJB64668.1| hypothetical protein B456_010G060100 [Gossypium raimondii] Length = 484 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DTN+Y+KIG DSA EFWFQ PPKI PDVPY FG+ G Sbjct: 127 DTNFYYKIGTGDSAREFWFQTPPKIGPDVPYKFGIIG 163 >gb|KJB64666.1| hypothetical protein B456_010G060100 [Gossypium raimondii] Length = 477 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DTN+Y+KIG DSA EFWFQ PPKI PDVPY FG+ G Sbjct: 127 DTNFYYKIGTGDSAREFWFQTPPKIGPDVPYKFGIIG 163 >ref|XP_012449720.1| PREDICTED: bifunctional purple acid phosphatase 26 [Gossypium raimondii] gi|763797708|gb|KJB64663.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797709|gb|KJB64664.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797712|gb|KJB64667.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797715|gb|KJB64670.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797716|gb|KJB64671.1| hypothetical protein B456_010G060100 [Gossypium raimondii] Length = 477 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DTN+Y+KIG DSA EFWFQ PPKI PDVPY FG+ G Sbjct: 127 DTNFYYKIGTGDSAREFWFQTPPKIGPDVPYKFGIIG 163 >gb|KJB64662.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797710|gb|KJB64665.1| hypothetical protein B456_010G060100 [Gossypium raimondii] gi|763797714|gb|KJB64669.1| hypothetical protein B456_010G060100 [Gossypium raimondii] Length = 453 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DTN+Y+KIG DSA EFWFQ PPKI PDVPY FG+ G Sbjct: 127 DTNFYYKIGTGDSAREFWFQTPPKIGPDVPYKFGIIG 163 >ref|XP_002515485.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative [Ricinus communis] gi|223545429|gb|EEF46934.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative [Ricinus communis] Length = 469 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT Y++KIG+ DS+ EFWF+ PPKIDPD PYTFG+ G Sbjct: 125 DTKYFYKIGEGDSSREFWFRTPPKIDPDAPYTFGIIG 161 >ref|XP_010250242.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nelumbo nucifera] Length = 531 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIG DSA EFWFQ PPK+ PD PYTFG+ G Sbjct: 181 DTKYYYKIGKGDSAREFWFQTPPKLGPDAPYTFGIIG 217 >ref|XP_010096988.1| Bifunctional purple acid phosphatase 26 [Morus notabilis] gi|587877580|gb|EXB66615.1| Bifunctional purple acid phosphatase 26 [Morus notabilis] Length = 417 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+K+G DSA EFWF+ PPKIDPD PY FG+ G Sbjct: 211 DTKYYYKLGSGDSAREFWFETPPKIDPDAPYKFGIIG 247 >ref|XP_010648745.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera] gi|731386095|ref|XP_010648746.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera] gi|296082127|emb|CBI21132.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIGD S+ EFWFQ PPKIDPD YTFG+ G Sbjct: 133 DTKYYYKIGDGGSSREFWFQTPPKIDPDTSYTFGIIG 169 >gb|KJB83221.1| hypothetical protein B456_013G236000 [Gossypium raimondii] Length = 462 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+K GD DSA EFWFQ PP I PDVPY FG+ G Sbjct: 127 DTKYYYKTGDGDSAREFWFQTPPMIGPDVPYKFGIIG 163 >ref|XP_012464349.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Gossypium raimondii] gi|823263173|ref|XP_012464350.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Gossypium raimondii] gi|763816367|gb|KJB83219.1| hypothetical protein B456_013G236000 [Gossypium raimondii] gi|763816368|gb|KJB83220.1| hypothetical protein B456_013G236000 [Gossypium raimondii] Length = 475 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+K GD DSA EFWFQ PP I PDVPY FG+ G Sbjct: 127 DTKYYYKTGDGDSAREFWFQTPPMIGPDVPYKFGIIG 163 >gb|KHG11290.1| Bifunctional purple acid phosphatase 26 -like protein [Gossypium arboreum] Length = 477 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT +Y+KIG DSA EFWFQ PPKI PDVPY FG+ G Sbjct: 127 DTKFYYKIGTGDSAREFWFQTPPKIGPDVPYKFGIIG 163 >ref|XP_007013584.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao] gi|508783947|gb|EOY31203.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao] Length = 489 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIG DSA EFWFQ PP+I PDVPY FG+ G Sbjct: 133 DTKYYYKIGTGDSAREFWFQTPPEIGPDVPYKFGIIG 169 >ref|XP_007013583.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao] gi|508783946|gb|EOY31202.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao] Length = 483 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIG DSA EFWFQ PP+I PDVPY FG+ G Sbjct: 133 DTKYYYKIGTGDSAREFWFQTPPEIGPDVPYKFGIIG 169 >ref|XP_007013582.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao] gi|508783945|gb|EOY31201.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao] Length = 477 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+KIG DSA EFWFQ PP+I PDVPY FG+ G Sbjct: 127 DTKYYYKIGTGDSAREFWFQTPPEIGPDVPYKFGIIG 163 >gb|AET86956.1| PAP26 [Gossypium hirsutum] Length = 476 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 263 DTNYYFKIGDCDSANEFWFQMPPKIDPDVPYTFGVSG 153 DT YY+K GD DSA EFWFQ PP I PDVPY FG+ G Sbjct: 127 DTKYYYKTGDGDSAREFWFQTPPMIGPDVPYKFGIIG 163