BLASTX nr result
ID: Aconitum23_contig00029840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029840 (355 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008218863.1| PREDICTED: uncharacterized protein LOC103319... 58 3e-06 ref|XP_007223343.1| hypothetical protein PRUPE_ppa009539mg [Prun... 58 3e-06 >ref|XP_008218863.1| PREDICTED: uncharacterized protein LOC103319136 [Prunus mume] Length = 255 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 352 DLKVHPALKLIQAKDEAVCNVKGARVTEQKKSK 254 DLKVHPALKL+Q+KDE VC + GARV+EQKKSK Sbjct: 223 DLKVHPALKLLQSKDEPVCKIMGARVSEQKKSK 255 >ref|XP_007223343.1| hypothetical protein PRUPE_ppa009539mg [Prunus persica] gi|462420279|gb|EMJ24542.1| hypothetical protein PRUPE_ppa009539mg [Prunus persica] Length = 287 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 352 DLKVHPALKLIQAKDEAVCNVKGARVTEQKKSK 254 DLKVHPALKL+Q+KDE VC + GARV+EQKKSK Sbjct: 255 DLKVHPALKLLQSKDEPVCKIMGARVSEQKKSK 287