BLASTX nr result
ID: Aconitum23_contig00029745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029745 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010110463.1| hypothetical protein L484_001862 [Morus nota... 57 5e-06 gb|KJB24039.1| hypothetical protein B456_004G126800 [Gossypium r... 56 9e-06 >ref|XP_010110463.1| hypothetical protein L484_001862 [Morus notabilis] gi|587939827|gb|EXC26461.1| hypothetical protein L484_001862 [Morus notabilis] Length = 275 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 92 RTEALERSLRQNVGWQKLIKRGVHTLRKPQ 3 RT ALE+SLR+NVGWQK IKRGVHTL+KPQ Sbjct: 217 RTAALEKSLRENVGWQKFIKRGVHTLKKPQ 246 >gb|KJB24039.1| hypothetical protein B456_004G126800 [Gossypium raimondii] Length = 402 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 98 TQRTEALERSLRQNVGWQKLIKRGVHTLRKPQ 3 T T ALERSL+ NVGWQKLIKRGVHTL+KPQ Sbjct: 342 TDGTVALERSLKTNVGWQKLIKRGVHTLKKPQ 373