BLASTX nr result
ID: Aconitum23_contig00029591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029591 (632 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276158.1| PREDICTED: cysteine-rich and transmembrane d... 61 5e-07 ref|XP_011000207.1| PREDICTED: cysteine-rich and transmembrane d... 57 7e-06 >ref|XP_010276158.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Nelumbo nucifera] Length = 83 Score = 61.2 bits (147), Expect = 5e-07 Identities = 31/51 (60%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = -3 Query: 150 TGMAYPPPQSYPPTMEGYS-QGPYVKAPPPAGYPTYDAQKHQQTPHGAETK 1 T AYPPPQSYPP EGY QGPYV PPPAGYP D + Q+ ETK Sbjct: 10 TPEAYPPPQSYPPPAEGYPYQGPYV-VPPPAGYPMKDGHGYPQSASQVETK 59 >ref|XP_011000207.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Populus euphratica] Length = 102 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -3 Query: 135 PPPQSYPPTMEGYSQGPYVKAPPPAGYPTYDAQKH-QQTPHGAETK 1 PPPQSYPP ++GY QG YV APPP GYP + +H QQ P ETK Sbjct: 34 PPPQSYPPPVQGYPQGHYV-APPPMGYPMKNGPQHPQQPPPPPETK 78