BLASTX nr result
ID: Aconitum23_contig00029589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00029589 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101763.1| PREDICTED: ninja-family protein AFP1-like [S... 56 9e-06 >ref|XP_011101763.1| PREDICTED: ninja-family protein AFP1-like [Sesamum indicum] Length = 435 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +1 Query: 94 NKMDSRDFLQRFVAE-SKHQLMERSEESGEIELNLGLSLGGRFGVEVKTTRLLRSLS 261 N SRD LQRF+ S+++ + EE EIELNLGLSLGGRFGV+ + +L+RS S Sbjct: 58 NSRLSRDLLQRFMGTASEYEEAVKEEEDEEIELNLGLSLGGRFGVDKSSQKLVRSSS 114