BLASTX nr result
ID: Aconitum23_contig00028859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028859 (543 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72441.1| hypothetical protein M569_02317, partial [Genlise... 56 9e-06 >gb|EPS72441.1| hypothetical protein M569_02317, partial [Genlisea aurea] Length = 1590 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -3 Query: 541 VFIIRTLLAYHFLSDPLAYTSDHTRLIHICITPFR*LKDCSWKS 410 VF++R LLAY LSDP Y SDH RLI IC TPFR C S Sbjct: 652 VFVVRVLLAYQALSDPYLYASDHARLIQICTTPFREASKCDESS 695