BLASTX nr result
ID: Aconitum23_contig00028581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00028581 (1147 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008810901.1| PREDICTED: probable receptor-like protein ki... 66 5e-08 >ref|XP_008810901.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Phoenix dactylifera] Length = 613 Score = 66.2 bits (160), Expect = 5e-08 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +3 Query: 540 HYFFYSVGYQMDACTDSFLETNGRAIEEEVSKKLDMYSRMLMQSAECSKDERVLFV 707 H + +GYQ+ ACTDSF TN RA+EEE+S+KLD+Y ML+QSAE K E V + Sbjct: 57 HTVTHPMGYQIKACTDSFFGTNSRALEEEISRKLDLYESMLLQSAEQCKAEGVSMI 112