BLASTX nr result
ID: Aconitum23_contig00026202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00026202 (399 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521951.1| conserved hypothetical protein [Ricinus comm... 57 7e-06 >ref|XP_002521951.1| conserved hypothetical protein [Ricinus communis] gi|223538755|gb|EEF40355.1| conserved hypothetical protein [Ricinus communis] Length = 133 Score = 56.6 bits (135), Expect = 7e-06 Identities = 36/86 (41%), Positives = 45/86 (52%), Gaps = 9/86 (10%) Frame = +1 Query: 22 MDKLRMQHSSM----KRQSH-KIKRKPTKIVYIGNPRMFKANNCFEFRQIVQQLTGQHSE 186 M KL Q+ K Q H K K+KP KI YI NP + +A N EFR IVQ+LTG+ S+ Sbjct: 1 MGKLSKQYFQQGQLPKSQKHTKNKKKPVKITYISNPTLVRATNASEFRAIVQELTGKDSK 60 Query: 187 P----SFGPTLTTHAEVGTNTPVYTS 252 P T+H E + P Y S Sbjct: 61 VLDTWDPDPYTTSHEEAASQVPNYES 86