BLASTX nr result
ID: Aconitum23_contig00025018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00025018 (829 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010268264.1| PREDICTED: putative RNA-binding protein Luc7... 61 9e-07 ref|XP_010268263.1| PREDICTED: putative RNA-binding protein Luc7... 61 9e-07 ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7... 61 9e-07 emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] 61 9e-07 ref|XP_011649045.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 gb|KGN61362.1| hypothetical protein Csa_2G099460 [Cucumis sativus] 60 1e-06 ref|XP_009414663.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_009414661.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_008441726.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_008441724.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_014523201.1| PREDICTED: putative RNA-binding protein Luc7... 60 2e-06 gb|KHN40487.1| Putative RNA-binding protein Luc7-like 1 [Glycine... 60 2e-06 gb|KHN29257.1| Putative RNA-binding protein Luc7-like 1 [Glycine... 60 2e-06 ref|XP_008370934.1| PREDICTED: putative RNA-binding protein Luc7... 60 2e-06 ref|XP_007139710.1| hypothetical protein PHAVU_008G052700g [Phas... 60 2e-06 ref|XP_004492854.1| PREDICTED: putative RNA-binding protein Luc7... 60 2e-06 ref|XP_003534502.1| PREDICTED: putative RNA-binding protein Luc7... 60 2e-06 ref|XP_003624200.1| RNA-binding LUC7-like protein [Medicago trun... 60 2e-06 ref|NP_001239802.1| uncharacterized protein LOC100793888 [Glycin... 60 2e-06 ref|XP_010258486.1| PREDICTED: putative RNA-binding protein Luc7... 60 3e-06 >ref|XP_010268264.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X2 [Nelumbo nucifera] Length = 418 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_010268263.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X1 [Nelumbo nucifera] Length = 428 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Vitis vinifera] gi|297735244|emb|CBI17606.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] Length = 419 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_011649045.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X3 [Cucumis sativus] Length = 329 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC +F VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYEEGK 72 >gb|KGN61362.1| hypothetical protein Csa_2G099460 [Cucumis sativus] Length = 335 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC +F VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYEEGK 72 >ref|XP_009414663.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X3 [Musa acuminata subsp. malaccensis] gi|695053172|ref|XP_009414665.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X3 [Musa acuminata subsp. malaccensis] Length = 315 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEKV 391 +DVC LF GL +L Q TK+DMGPCPK++ LQLR +Y+E KV Sbjct: 30 RDVCRLFLAGLCPHDLFQLTKMDMGPCPKIHSLQLRKEYEEAKV 73 >ref|XP_009414661.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 417 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEKV 391 +DVC LF GL +L Q TK+DMGPCPK++ LQLR +Y+E KV Sbjct: 30 RDVCRLFLAGLCPHDLFQLTKMDMGPCPKIHSLQLRKEYEEAKV 73 >ref|XP_008441726.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X2 [Cucumis melo] gi|778668125|ref|XP_011649044.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X2 [Cucumis sativus] Length = 336 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC +F VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYEEGK 72 >ref|XP_008441724.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X1 [Cucumis melo] gi|778668120|ref|XP_011649043.1| PREDICTED: putative RNA-binding protein Luc7-like 2 isoform X1 [Cucumis sativus] Length = 413 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC +F VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYEEGK 72 >ref|XP_014523201.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Vigna radiata var. radiata] Length = 414 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >gb|KHN40487.1| Putative RNA-binding protein Luc7-like 1 [Glycine soja] Length = 413 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >gb|KHN29257.1| Putative RNA-binding protein Luc7-like 1 [Glycine soja] Length = 443 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_008370934.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Malus domestica] Length = 245 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_007139710.1| hypothetical protein PHAVU_008G052700g [Phaseolus vulgaris] gi|561012843|gb|ESW11704.1| hypothetical protein PHAVU_008G052700g [Phaseolus vulgaris] Length = 414 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_004492854.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Cicer arietinum] Length = 412 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_003534502.1| PREDICTED: putative RNA-binding protein Luc7-like 2-like [Glycine max] gi|947091615|gb|KRH40280.1| hypothetical protein GLYMA_09G248800 [Glycine max] Length = 414 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_003624200.1| RNA-binding LUC7-like protein [Medicago truncatula] gi|355499215|gb|AES80418.1| RNA-binding LUC7-like protein [Medicago truncatula] Length = 410 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|NP_001239802.1| uncharacterized protein LOC100793888 [Glycine max] gi|255636477|gb|ACU18577.1| unknown [Glycine max] gi|947051419|gb|KRH00948.1| hypothetical protein GLYMA_18G243900 [Glycine max] Length = 414 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_010258486.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Nelumbo nucifera] Length = 425 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 260 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 388 +DVC LF GL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72