BLASTX nr result
ID: Aconitum23_contig00024833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024833 (466 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containi... 54 5e-08 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 54 5e-08 ref|XP_010260148.1| PREDICTED: pentatricopeptide repeat-containi... 52 1e-07 >ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Vitis vinifera] Length = 852 Score = 53.5 bits (127), Expect(2) = 5e-08 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 394 KNEFPTHSKSLARRPAVIRRLKVTKKSLYHWLQKRVGMGR 275 +N PT +S RRPAV++R KVT+KSL HWLQ+RVG R Sbjct: 812 RNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRRVGATR 851 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 458 VVKLLRDELGLSVVMEGPK 402 ++KLL+DELGL V GPK Sbjct: 769 IIKLLQDELGLEVAFAGPK 787 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Length = 842 Score = 53.5 bits (127), Expect(2) = 5e-08 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 394 KNEFPTHSKSLARRPAVIRRLKVTKKSLYHWLQKRVGMGR 275 +N PT +S RRPAV++R KVT+KSL HWLQ+RVG R Sbjct: 802 RNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRRVGATR 841 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 458 VVKLLRDELGLSVVMEGPK 402 ++KLL+DELGL V GPK Sbjct: 759 IIKLLQDELGLEVAFAGPK 777 >ref|XP_010260148.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Nelumbo nucifera] Length = 857 Score = 52.4 bits (124), Expect(2) = 1e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 394 KNEFPTHSKSLARRPAVIRRLKVTKKSLYHWLQKRVGMGR 275 KN +SLARRP V++RLKVTKKSLY+WLQ+ +G R Sbjct: 817 KNGLLVECESLARRPVVLQRLKVTKKSLYYWLQRSIGATR 856 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 464 NTVVKLLRDELGLSVVMEGPK 402 N ++KLLRDELGL VV G + Sbjct: 774 NVIIKLLRDELGLEVVGAGSR 794