BLASTX nr result
ID: Aconitum23_contig00024651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024651 (546 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081781.1| PREDICTED: probable E3 ubiquitin-protein lig... 58 2e-06 ref|XP_011081780.1| PREDICTED: ultraviolet-B receptor UVR8 isofo... 58 2e-06 ref|XP_010249570.1| PREDICTED: guanine nucleotide exchange facto... 58 2e-06 gb|ACL53116.1| unknown [Zea mays] gi|224034505|gb|ACN36328.1| un... 58 3e-06 ref|NP_001130888.1| uncharacterized protein LOC100191992 [Zea ma... 58 3e-06 ref|XP_002456275.1| hypothetical protein SORBIDRAFT_03g033330 [S... 58 3e-06 ref|XP_010102398.1| hypothetical protein L484_010711 [Morus nota... 57 4e-06 ref|XP_007012140.1| Regulator of chromosome condensation family ... 57 5e-06 ref|XP_007012139.1| Regulator of chromosome condensation family ... 57 5e-06 ref|XP_007012138.1| Regulator of chromosome condensation family ... 57 5e-06 ref|XP_010249568.1| PREDICTED: guanine nucleotide exchange facto... 57 7e-06 ref|XP_010249567.1| PREDICTED: guanine nucleotide exchange facto... 57 7e-06 ref|XP_010249566.1| PREDICTED: guanine nucleotide exchange facto... 57 7e-06 ref|XP_010249565.1| PREDICTED: guanine nucleotide exchange facto... 57 7e-06 ref|XP_010249564.1| PREDICTED: guanine nucleotide exchange facto... 57 7e-06 >ref|XP_011081781.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform X2 [Sesamum indicum] Length = 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ+S FDIAKEWEN LDS+D KL R+++FYR+M++GV Sbjct: 459 LQNSGTFDIAKEWENMLDSSDQRKLARLEMFYRDMLAGV 497 >ref|XP_011081780.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Sesamum indicum] Length = 580 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ+S FDIAKEWEN LDS+D KL R+++FYR+M++GV Sbjct: 516 LQNSGTFDIAKEWENMLDSSDQRKLARLEMFYRDMLAGV 554 >ref|XP_010249570.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X6 [Nelumbo nucifera] gi|719979712|ref|XP_010249571.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X6 [Nelumbo nucifera] Length = 590 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGVXXXXXXXXXXXXXXXXLHSST 367 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV LHSST Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGVKDKLLRRKIQEVFKECLHSST 589 >gb|ACL53116.1| unknown [Zea mays] gi|224034505|gb|ACN36328.1| unknown [Zea mays] gi|414880673|tpg|DAA57804.1| TPA: putative regulator of chromosome condensation (RCC1) family protein isoform 1 [Zea mays] gi|414880674|tpg|DAA57805.1| TPA: putative regulator of chromosome condensation (RCC1) family protein isoform 2 [Zea mays] Length = 416 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ SS FDI KE+EN LD+AD ++LNR+++FYR+M+SGV Sbjct: 352 LQESSVFDIRKEFENILDAADTDELNRLEIFYRSMLSGV 390 >ref|NP_001130888.1| uncharacterized protein LOC100191992 [Zea mays] gi|194690372|gb|ACF79270.1| unknown [Zea mays] gi|219884485|gb|ACL52617.1| unknown [Zea mays] gi|219885259|gb|ACL53004.1| unknown [Zea mays] gi|219885461|gb|ACL53105.1| unknown [Zea mays] gi|238010394|gb|ACR36232.1| unknown [Zea mays] gi|414880676|tpg|DAA57807.1| TPA: putative regulator of chromosome condensation (RCC1) family protein [Zea mays] Length = 556 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ SS FDI KE+EN LD+AD ++LNR+++FYR+M+SGV Sbjct: 492 LQESSVFDIRKEFENILDAADTDELNRLEIFYRSMLSGV 530 >ref|XP_002456275.1| hypothetical protein SORBIDRAFT_03g033330 [Sorghum bicolor] gi|241928250|gb|EES01395.1| hypothetical protein SORBIDRAFT_03g033330 [Sorghum bicolor] Length = 560 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ SS FDI KE+EN LD+AD ++LNR+++FYR+M+SGV Sbjct: 495 LQESSVFDIRKEFENILDAADTDELNRLEIFYRSMLSGV 533 >ref|XP_010102398.1| hypothetical protein L484_010711 [Morus notabilis] gi|587905198|gb|EXB93383.1| hypothetical protein L484_010711 [Morus notabilis] Length = 600 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L +S FDIAKEWEN L+SAD KL R+++FYRNM+SGV Sbjct: 541 LLNSGTFDIAKEWENMLESADRAKLMRLEMFYRNMLSGV 579 >ref|XP_007012140.1| Regulator of chromosome condensation family protein isoform 3 [Theobroma cacao] gi|590573506|ref|XP_007012141.1| Regulator of chromosome condensation family protein isoform 3 [Theobroma cacao] gi|508782503|gb|EOY29759.1| Regulator of chromosome condensation family protein isoform 3 [Theobroma cacao] gi|508782504|gb|EOY29760.1| Regulator of chromosome condensation family protein isoform 3 [Theobroma cacao] Length = 485 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ+S FD+A+EWEN L+S+D KL R++LFYRNM++GV Sbjct: 423 LQNSGTFDVAREWENMLESSDRSKLVRLELFYRNMLAGV 461 >ref|XP_007012139.1| Regulator of chromosome condensation family protein isoform 2 [Theobroma cacao] gi|508782502|gb|EOY29758.1| Regulator of chromosome condensation family protein isoform 2 [Theobroma cacao] Length = 571 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ+S FD+A+EWEN L+S+D KL R++LFYRNM++GV Sbjct: 509 LQNSGTFDVAREWENMLESSDRSKLVRLELFYRNMLAGV 547 >ref|XP_007012138.1| Regulator of chromosome condensation family protein isoform 1 [Theobroma cacao] gi|508782501|gb|EOY29757.1| Regulator of chromosome condensation family protein isoform 1 [Theobroma cacao] Length = 583 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 LQ+S FD+A+EWEN L+S+D KL R++LFYRNM++GV Sbjct: 521 LQNSGTFDVAREWENMLESSDRSKLVRLELFYRNMLAGV 559 >ref|XP_010249568.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X5 [Nelumbo nucifera] Length = 661 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGV 568 >ref|XP_010249567.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X4 [Nelumbo nucifera] Length = 664 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGV 568 >ref|XP_010249566.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X3 [Nelumbo nucifera] Length = 671 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGV 568 >ref|XP_010249565.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X2 [Nelumbo nucifera] Length = 671 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGV 568 >ref|XP_010249564.1| PREDICTED: guanine nucleotide exchange factor SRM1 isoform X1 [Nelumbo nucifera] Length = 691 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 546 LQSSSAFDIAKEWENTLDSADVEKLNRMQLFYRNMISGV 430 L+ S FDIAKEW+N L+SAD KL R+++FYRNM+SGV Sbjct: 530 LRDSGTFDIAKEWDNMLESADSGKLVRLEMFYRNMLSGV 568