BLASTX nr result
ID: Aconitum23_contig00024600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00024600 (570 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] 49 2e-10 >emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] Length = 1014 Score = 49.3 bits (116), Expect(2) = 2e-10 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = -1 Query: 246 YMTSIPFSLDNLMP*TVKSIQVANGDPMPVSGTGNISFSP 127 +MTS LD+LMP VK + V+NG PMP+SG N+SFSP Sbjct: 886 HMTSHSSLLDSLMPSLVKFVHVSNGTPMPISGARNVSFSP 925 Score = 43.1 bits (100), Expect(2) = 2e-10 Identities = 18/22 (81%), Positives = 22/22 (100%) Frame = -2 Query: 68 ISKISKHLNCSVTFHSSHCVFQ 3 ISKI+K+LNCSVTF+S+HCVFQ Sbjct: 945 ISKITKNLNCSVTFNSTHCVFQ 966