BLASTX nr result
ID: Aconitum23_contig00022984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00022984 (605 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254707.1| PREDICTED: uncharacterized protein LOC104595... 61 5e-07 ref|XP_009785898.1| PREDICTED: DNA ligase 1 [Nicotiana sylvestris] 60 1e-06 >ref|XP_010254707.1| PREDICTED: uncharacterized protein LOC104595608 [Nelumbo nucifera] Length = 423 Score = 60.8 bits (146), Expect = 5e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +3 Query: 255 QKSDKSPKLNIPGSAKRLRVKEKAVLAGAFSKYGSKGSLSLTKER 389 + S K PKLN+PGSAKRL+V+EKAVL G FSKYG SL+ +ER Sbjct: 379 RNSAKPPKLNVPGSAKRLKVREKAVLTGVFSKYGGNPSLTSQEER 423 >ref|XP_009785898.1| PREDICTED: DNA ligase 1 [Nicotiana sylvestris] Length = 423 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 255 QKSDKSPKLNIPGSAKRLRVKEKAVLAGAFSKYGSKGSLSLTKER 389 QK DK PKLNIPGSA++L++KEKA+L G SKY K +++ KE+ Sbjct: 378 QKKDKVPKLNIPGSARKLKIKEKALLTGVISKYAQKNTVATVKEQ 422