BLASTX nr result
ID: Aconitum23_contig00020614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00020614 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10916.1| unnamed protein product [Coffea canephora] 57 7e-06 >emb|CDP10916.1| unnamed protein product [Coffea canephora] Length = 496 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -2 Query: 519 ALNAKISEPIHLHRVRNVAPYKAMYCLSFILPEETCVD 406 ALNA I PI H+VR+VAP KAMYCLSF LPEE CVD Sbjct: 455 ALNASIQNPI-FHKVRDVAPNKAMYCLSFRLPEEACVD 491