BLASTX nr result
ID: Aconitum23_contig00018790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00018790 (439 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835866.1| PREDICTED: embryonic protein DC-8 [Erythrant... 62 2e-07 >ref|XP_012835866.1| PREDICTED: embryonic protein DC-8 [Erythranthe guttatus] gi|604334511|gb|EYU38595.1| hypothetical protein MIMGU_mgv1a021925mg [Erythranthe guttata] Length = 504 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -2 Query: 429 GVAET-AVERIRIDRNGVERIRMDLEKTPAGEVASKLKASDAMSGQAFNDVGSMEDETVA 253 GVAE R+ +D G + +E+TPAG VA+ LKA+D M+GQAFNDVG++ DE VA Sbjct: 438 GVAEAKGGRRLAVDEEGTPVV---MEETPAGGVAATLKATDQMTGQAFNDVGAVADEGVA 494 Query: 252 DARIDSP 232 R+D P Sbjct: 495 RVRLDRP 501