BLASTX nr result
ID: Aconitum23_contig00014998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00014998 (1004 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527654.1| RNA binding protein, putative [Ricinus commu... 70 2e-09 ref|XP_013698038.1| PREDICTED: RNA-binding protein 34-like [Bras... 70 3e-09 ref|XP_013698030.1| PREDICTED: RNA-binding protein 34-like [Bras... 70 3e-09 ref|XP_013597688.1| PREDICTED: RNA-binding protein 34-like [Bras... 70 3e-09 ref|XP_010530020.1| PREDICTED: RNA-binding protein 34 [Tarenaya ... 70 3e-09 ref|XP_009101482.1| PREDICTED: RNA-binding protein 34 [Brassica ... 70 3e-09 emb|CDY72576.1| BnaCnng78380D [Brassica napus] 70 3e-09 gb|EPS65135.1| hypothetical protein M569_09644, partial [Genlise... 70 3e-09 ref|NP_199496.1| RNA recognition motif-containing protein [Arabi... 70 3e-09 ref|XP_002865157.1| RNA recognition motif-containing protein [Ar... 70 3e-09 ref|NP_001078722.1| RNA recognition motif-containing protein [Ar... 70 3e-09 gb|AAM63703.1| unknown [Arabidopsis thaliana] 70 3e-09 ref|XP_013706367.1| PREDICTED: RNA-binding protein 34-like [Bras... 69 5e-09 emb|CDX77700.1| BnaC07g19540D [Brassica napus] 69 5e-09 emb|CDY33483.1| BnaA06g35900D [Brassica napus] 69 5e-09 ref|XP_008238216.1| PREDICTED: RNA-binding protein 34 [Prunus mume] 69 6e-09 ref|XP_002303427.2| RNA recognition motif-containing family prot... 69 6e-09 ref|XP_010096968.1| RNA-binding protein 34 [Morus notabilis] gi|... 68 1e-08 ref|XP_011070301.1| PREDICTED: RNA-binding protein 34 [Sesamum i... 68 1e-08 gb|KHN38936.1| RNA-binding protein 34 [Glycine soja] 68 1e-08 >ref|XP_002527654.1| RNA binding protein, putative [Ricinus communis] gi|223532959|gb|EEF34725.1| RNA binding protein, putative [Ricinus communis] Length = 830 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -3 Query: 168 VIYKFAGEGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 ++ K GEGFDDE KLLR++FVGNLP EFS+FGE++S+RIR++PIVD Sbjct: 146 LVSKEGGEGFDDESKLLRTVFVGNLPLKMKKKTLVKEFSQFGEIDSVRIRSVPIVD 201 >ref|XP_013698038.1| PREDICTED: RNA-binding protein 34-like [Brassica napus] Length = 491 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 148 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESVRIRSVPIVD 196 >ref|XP_013698030.1| PREDICTED: RNA-binding protein 34-like [Brassica napus] Length = 491 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 148 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESVRIRSVPIVD 196 >ref|XP_013597688.1| PREDICTED: RNA-binding protein 34-like [Brassica oleracea var. oleracea] Length = 494 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 151 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESVRIRSVPIVD 199 >ref|XP_010530020.1| PREDICTED: RNA-binding protein 34 [Tarenaya hassleriana] Length = 526 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 191 EGFDDESKLLRTVFVGNLPLKIKKKAILKEFSKFGEVESVRIRSVPIVD 239 >ref|XP_009101482.1| PREDICTED: RNA-binding protein 34 [Brassica rapa] Length = 492 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 149 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESVRIRSVPIVD 197 >emb|CDY72576.1| BnaCnng78380D [Brassica napus] Length = 480 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 137 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESVRIRSVPIVD 185 >gb|EPS65135.1| hypothetical protein M569_09644, partial [Genlisea aurea] Length = 196 Score = 69.7 bits (169), Expect = 3e-09 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDEDKL+R+IFVGNLP EF KFGE+ES+RIR++PIVD Sbjct: 55 EGFDDEDKLMRTIFVGNLPLKAKKKELLKEFGKFGEIESVRIRSVPIVD 103 >ref|NP_199496.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|8809667|dbj|BAA97218.1| unnamed protein product [Arabidopsis thaliana] gi|32441262|gb|AAP81806.1| At5g46840 [Arabidopsis thaliana] gi|110736326|dbj|BAF00133.1| hypothetical protein [Arabidopsis thaliana] gi|332008049|gb|AED95432.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 501 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 161 EGFDDESKLLRTVFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIVD 209 >ref|XP_002865157.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310992|gb|EFH41416.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 509 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 167 EGFDDESKLLRTVFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIVD 215 >ref|NP_001078722.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|222424348|dbj|BAH20130.1| AT5G46840 [Arabidopsis thaliana] gi|332008050|gb|AED95433.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 364 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 24 EGFDDESKLLRTVFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIVD 72 >gb|AAM63703.1| unknown [Arabidopsis thaliana] Length = 501 Score = 69.7 bits (169), Expect = 3e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 161 EGFDDESKLLRTVFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIVD 209 >ref|XP_013706367.1| PREDICTED: RNA-binding protein 34-like [Brassica napus] Length = 494 Score = 69.3 bits (168), Expect = 5e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 151 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESLRIRSVPIVD 199 >emb|CDX77700.1| BnaC07g19540D [Brassica napus] Length = 480 Score = 69.3 bits (168), Expect = 5e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 137 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESLRIRSVPIVD 185 >emb|CDY33483.1| BnaA06g35900D [Brassica napus] Length = 480 Score = 69.3 bits (168), Expect = 5e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PIVD Sbjct: 137 EGFDDESKLLRTVFVGNLPLKVKKKLILKEFSKFGEVESLRIRSVPIVD 185 >ref|XP_008238216.1| PREDICTED: RNA-binding protein 34 [Prunus mume] Length = 551 Score = 68.9 bits (167), Expect = 6e-09 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 153 AGEGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 + EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PI+D Sbjct: 218 SNEGFDDESKLLRTVFVGNLPLKVKKKVLIKEFSKFGEVESVRIRSVPILD 268 >ref|XP_002303427.2| RNA recognition motif-containing family protein [Populus trichocarpa] gi|550342807|gb|EEE78406.2| RNA recognition motif-containing family protein [Populus trichocarpa] Length = 491 Score = 68.9 bits (167), Expect = 6e-09 Identities = 36/72 (50%), Positives = 46/72 (63%) Frame = -3 Query: 216 RVHLGSSYRYVLLLVRVIYKFAGEGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEV 37 RV +G+ + V+ GEGFDDE KLLR++FVGNLP EFSKFGEV Sbjct: 135 RVVVGAKRKKADDAADVLVSKEGEGFDDERKLLRTVFVGNLPLKVKKKALIKEFSKFGEV 194 Query: 36 ESIRIRTLPIVD 1 ES+RIR++PI + Sbjct: 195 ESLRIRSMPITE 206 >ref|XP_010096968.1| RNA-binding protein 34 [Morus notabilis] gi|587877507|gb|EXB66545.1| RNA-binding protein 34 [Morus notabilis] Length = 510 Score = 68.2 bits (165), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EFSKFGEVES+RIR++PI D Sbjct: 181 EGFDDESKLLRTVFVGNLPLSTKKKALIKEFSKFGEVESVRIRSVPITD 229 >ref|XP_011070301.1| PREDICTED: RNA-binding protein 34 [Sesamum indicum] Length = 549 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDE KLLR++FVGNLP EF+KFGEVES+RIR++PI+D Sbjct: 220 EGFDDESKLLRTVFVGNLPLKLKKKEIVKEFAKFGEVESVRIRSVPIID 268 >gb|KHN38936.1| RNA-binding protein 34 [Glycine soja] Length = 342 Score = 68.2 bits (165), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 147 EGFDDEDKLLRSIFVGNLPXXXXXXXXXAEFSKFGEVESIRIRTLPIVD 1 EGFDDEDKLLR++FVGNLP EF KFGEVES+RIR++PI D Sbjct: 6 EGFDDEDKLLRTVFVGNLPLKVKKKTLLKEFKKFGEVESVRIRSVPIQD 54