BLASTX nr result
ID: Aconitum23_contig00012116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00012116 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010691259.1| PREDICTED: probable methyltransferase PMT11 ... 58 3e-06 gb|KNA20549.1| hypothetical protein SOVF_050940 [Spinacia oleracea] 57 4e-06 >ref|XP_010691259.1| PREDICTED: probable methyltransferase PMT11 [Beta vulgaris subsp. vulgaris] gi|870867522|gb|KMT18391.1| hypothetical protein BVRB_2g025430 [Beta vulgaris subsp. vulgaris] Length = 683 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -1 Query: 491 ELLDIAIGMGWRAGVHDSSEGPHASWKVFMCDKPTARR 378 EL +IA MGWRA +HD+SEGPHAS+KV CDK RR Sbjct: 646 ELQEIAKAMGWRAAIHDTSEGPHASYKVLACDKQLLRR 683 >gb|KNA20549.1| hypothetical protein SOVF_050940 [Spinacia oleracea] Length = 673 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -1 Query: 494 DELLDIAIGMGWRAGVHDSSEGPHASWKVFMCDKPTARR 378 +EL +IA MGWRA +HD+SEGPHAS+KV CDK R+ Sbjct: 635 EELQEIAKAMGWRAAIHDTSEGPHASYKVLSCDKQLLRK 673