BLASTX nr result
ID: Aconitum23_contig00007731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00007731 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006387344.1| hypothetical protein POPTR_1212s00200g, part... 60 8e-07 gb|KDO35833.1| hypothetical protein CISIN_1g036099mg, partial [C... 58 3e-06 gb|KDO74739.1| hypothetical protein CISIN_1g041455mg, partial [C... 57 7e-06 ref|XP_006419858.1| hypothetical protein CICLE_v10006596mg, part... 57 7e-06 >ref|XP_006387344.1| hypothetical protein POPTR_1212s00200g, partial [Populus trichocarpa] gi|550306661|gb|ERP46258.1| hypothetical protein POPTR_1212s00200g, partial [Populus trichocarpa] Length = 190 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = -2 Query: 206 VPDELWAEVLCRLPP-KDMVRCKIVSDSWNTLISQVCIPKI--TSPLHGFVILLKQ-GRG 39 +PD++ E+LCR+ K ++R K V SWN LI+ C+PKI +SPLHGF+ L K+ G G Sbjct: 25 LPDDVLVEILCRVTDRKHLIRLKSVCKSWNNLITDACVPKISASSPLHGFIYLAKKIGFG 84 Query: 38 EP 33 +P Sbjct: 85 KP 86 >gb|KDO35833.1| hypothetical protein CISIN_1g036099mg, partial [Citrus sinensis] Length = 279 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -2 Query: 200 DELWAEVLCRLPPKDMVRCKIVSDSWNTLISQVCIPKITSPLHGFVILLKQGRGEPCSRD 21 ++L E+LCRLP K + R KIVS +WN LIS VCIP+I S L GF+ E C Sbjct: 8 EDLITEILCRLPVKSVTRFKIVSKAWNNLISNVCIPRI-SNLSGFLF----HSTEDCMNY 62 Query: 20 FNYTIN 3 F+Y+ N Sbjct: 63 FSYSDN 68 >gb|KDO74739.1| hypothetical protein CISIN_1g041455mg, partial [Citrus sinensis] Length = 286 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 206 VPDELWAEVLCRLPPKDMVRCKIVSDSWNTLISQVCIPKI--TSPLHGFV 63 +P++L E+LCRLP K + KIVS +W+ LIS VCIP+I SPL GF+ Sbjct: 10 LPEDLITEILCRLPVKSVTGFKIVSKAWSNLISNVCIPRILRASPLSGFL 59 >ref|XP_006419858.1| hypothetical protein CICLE_v10006596mg, partial [Citrus clementina] gi|557521731|gb|ESR33098.1| hypothetical protein CICLE_v10006596mg, partial [Citrus clementina] Length = 350 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 206 VPDELWAEVLCRLPPKDMVRCKIVSDSWNTLISQVCIPKI--TSPLHGFV 63 +P++L E+LCRLP K + KIVS +W+ LIS VCIP+I SPL GF+ Sbjct: 6 LPEDLITEILCRLPVKSVTGFKIVSKAWSNLISNVCIPRILRASPLSGFL 55