BLASTX nr result
ID: Aconitum23_contig00007642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00007642 (640 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 95 4e-17 ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase ... 94 7e-17 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 94 7e-17 ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase ... 94 9e-17 gb|KNA14653.1| hypothetical protein SOVF_105100 isoform A [Spina... 92 2e-16 ref|XP_002529620.1| calcium-dependent protein kinase, putative [... 92 2e-16 ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase ... 92 2e-16 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 92 3e-16 ref|XP_010546723.1| PREDICTED: calcium-dependent protein kinase ... 92 3e-16 ref|XP_011075229.1| PREDICTED: calcium-dependent protein kinase ... 91 6e-16 ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase ... 91 6e-16 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 91 6e-16 ref|XP_012470708.1| PREDICTED: calcium-dependent protein kinase ... 91 7e-16 emb|CDP20654.1| unnamed protein product [Coffea canephora] 91 7e-16 ref|XP_009374937.1| PREDICTED: calcium-dependent protein kinase ... 90 1e-15 ref|XP_009369698.1| PREDICTED: calcium-dependent protein kinase ... 90 1e-15 ref|XP_008339082.1| PREDICTED: calcium-dependent protein kinase ... 90 1e-15 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 90 1e-15 ref|XP_011033316.1| PREDICTED: calcium-dependent protein kinase ... 89 2e-15 ref|XP_010257203.1| PREDICTED: calcium-dependent protein kinase ... 89 2e-15 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 94.7 bits (234), Expect = 4e-17 Identities = 47/63 (74%), Positives = 52/63 (82%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR*NT*NKHII 461 GRISY+EFA MMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q+N R NT +K ++ Sbjct: 486 GRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPRRPNTIDKVLL 545 Query: 460 CGN 452 N Sbjct: 546 MKN 548 >ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum] Length = 533 Score = 94.0 bits (232), Expect = 7e-17 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN+LSLKLM+DGS QV EGR Sbjct: 483 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQVGKEEGR 533 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 94.0 bits (232), Expect = 7e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISY+EFAAMMKAGTDWRKASRQYSRERFNNLSLKLM+DGS Q+N NEGR Sbjct: 485 GRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMN-NEGR 534 >ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase 8-like [Beta vulgaris subsp. vulgaris] gi|870842141|gb|KMS95633.1| hypothetical protein BVRB_006440 [Beta vulgaris subsp. vulgaris] Length = 529 Score = 93.6 bits (231), Expect = 9e-17 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q + NEGR Sbjct: 480 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQ-SANEGR 529 >gb|KNA14653.1| hypothetical protein SOVF_105100 isoform A [Spinacia oleracea] Length = 488 Score = 92.4 bits (228), Expect = 2e-16 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISY+EFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q + NEGR Sbjct: 439 GRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQ-SANEGR 488 >ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530905|gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 529 Score = 92.4 bits (228), Expect = 2e-16 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISY+EFA MMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q MNEGR Sbjct: 481 GRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQ--MNEGR 529 >ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum] Length = 532 Score = 92.4 bits (228), Expect = 2e-16 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFA MMKAGTDWRKASRQYSRERFN+LSLKLM+DGS QV EGR Sbjct: 482 GRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQVGKEEGR 532 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 92.0 bits (227), Expect = 3e-16 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKL+KDGS Q + NEGR Sbjct: 480 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQ-SANEGR 529 >ref|XP_010546723.1| PREDICTED: calcium-dependent protein kinase 32-like [Tarenaya hassleriana] Length = 533 Score = 91.7 bits (226), Expect = 3e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEG 491 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSL LM+DGSFQ N N+G Sbjct: 483 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLNLMRDGSFQFN-NDG 531 >ref|XP_011075229.1| PREDICTED: calcium-dependent protein kinase 32 isoform X2 [Sesamum indicum] Length = 454 Score = 90.9 bits (224), Expect = 6e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRER+N+LSLKLMKDGS Q+ NEGR Sbjct: 405 GRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQMG-NEGR 454 >ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase 32 isoform X1 [Sesamum indicum] Length = 530 Score = 90.9 bits (224), Expect = 6e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRER+N+LSLKLMKDGS Q+ NEGR Sbjct: 481 GRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGSLQMG-NEGR 530 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 90.9 bits (224), Expect = 6e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN+LSLKLM+DGS Q+ NEGR Sbjct: 483 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLT-NEGR 532 >ref|XP_012470708.1| PREDICTED: calcium-dependent protein kinase 32-like [Gossypium raimondii] gi|763751895|gb|KJB19283.1| hypothetical protein B456_003G092900 [Gossypium raimondii] Length = 535 Score = 90.5 bits (223), Expect = 7e-16 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISY+EFA MMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q+N NE R Sbjct: 486 GRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMN-NEPR 535 >emb|CDP20654.1| unnamed protein product [Coffea canephora] Length = 532 Score = 90.5 bits (223), Expect = 7e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN+LSLKLM+DGS Q+ NEGR Sbjct: 483 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL-ANEGR 532 >ref|XP_009374937.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Pyrus x bretschneideri] gi|694399654|ref|XP_009374938.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Pyrus x bretschneideri] gi|694399656|ref|XP_009374940.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Pyrus x bretschneideri] gi|694399659|ref|XP_009374941.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Pyrus x bretschneideri] Length = 533 Score = 90.1 bits (222), Expect = 1e-15 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN++SLKLM++GSF V+ NEGR Sbjct: 484 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSFTVS-NEGR 533 >ref|XP_009369698.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Pyrus x bretschneideri] Length = 533 Score = 90.1 bits (222), Expect = 1e-15 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN++SLKLM++GSF V+ NEGR Sbjct: 484 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSFTVS-NEGR 533 >ref|XP_008339082.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Malus domestica] gi|658007796|ref|XP_008339083.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X1 [Malus domestica] Length = 533 Score = 89.7 bits (221), Expect = 1e-15 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 GRISYEEFAAMMKAGTDWRKASRQYSRERFN++SLKLM++GSF V NEGR Sbjct: 484 GRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSFTVG-NEGR 533 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 89.7 bits (221), Expect = 1e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVN 503 GRISY+EFA MMKAGTDWRKASRQYSRERFNNLSLKLMKDGS Q+N Sbjct: 482 GRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMN 527 >ref|XP_011033316.1| PREDICTED: calcium-dependent protein kinase 32-like [Populus euphratica] Length = 532 Score = 89.4 bits (220), Expect = 2e-15 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNEGR 488 G+ISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS ++ +EGR Sbjct: 483 GKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLKLT-SEGR 532 >ref|XP_010257203.1| PREDICTED: calcium-dependent protein kinase 8-like [Nelumbo nucifera] Length = 535 Score = 89.4 bits (220), Expect = 2e-15 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 640 GRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSFQVNMNE 494 GRISYEEF AMMKAGTDWRKASRQYSRERFN+LSLKLMKDGS Q+ ++E Sbjct: 482 GRISYEEFTAMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQLRVDE 530