BLASTX nr result
ID: Aconitum23_contig00007360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00007360 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512928.1| ribonuclease t2, putative [Ricinus communis]... 58 2e-06 >ref|XP_002512928.1| ribonuclease t2, putative [Ricinus communis] gi|223547939|gb|EEF49431.1| ribonuclease t2, putative [Ricinus communis] Length = 237 Score = 58.2 bits (139), Expect = 2e-06 Identities = 37/97 (38%), Positives = 50/97 (51%), Gaps = 5/97 (5%) Frame = -1 Query: 408 FWANEWKKHGCFSGQTPAVYFQTSLNLYTAMGPLRQDLTSAECRPGLR----CDLAKLLK 241 FW+ EW+KHG SG A YF+ S+NL + L+ L +A RP + D+ K +K Sbjct: 116 FWSREWQKHGTCSGLKLADYFKNSINLVKGINILK-TLDNAGIRPDNKNYRIVDIKKAVK 174 Query: 240 AYDTKYPNRL-PRIVCTTNRGGTNQIQEFRFRVSAAG 133 K P +L P I C N G Q+ E R V+ AG Sbjct: 175 IAQNKQPLQLEPSIKCNVNTKGEIQLHEIRLCVNKAG 211