BLASTX nr result
ID: Aconitum23_contig00007270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00007270 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010247010.1| PREDICTED: oxygen-evolving enhancer protein ... 44 8e-09 ref|XP_010267815.1| PREDICTED: oxygen-evolving enhancer protein ... 41 2e-07 ref|XP_012450948.1| PREDICTED: oxygen-evolving enhancer protein ... 44 7e-06 gb|KHG11453.1| Oxygen-evolving enhancer 3, chloroplastic [Gossyp... 44 7e-06 ref|XP_006467954.1| PREDICTED: oxygen-evolving enhancer protein ... 39 9e-06 >ref|XP_010247010.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like [Nelumbo nucifera] Length = 235 Score = 44.3 bits (103), Expect(2) = 8e-09 Identities = 19/32 (59%), Positives = 29/32 (90%) Frame = +2 Query: 2 IPSNSRMAVSRASFTVRSQQVSSESDAMAQSS 97 +P N+R++VSR+ FTVR+QQVSSE ++++QSS Sbjct: 33 LPGNNRVSVSRSGFTVRAQQVSSEGESVSQSS 64 Score = 42.4 bits (98), Expect(2) = 8e-09 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 102 VLAEARSIKVGPPPPPSGGL 161 VLA+A+SIKVGPPPPPSGGL Sbjct: 85 VLADAKSIKVGPPPPPSGGL 104 >ref|XP_010267815.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like [Nelumbo nucifera] Length = 235 Score = 41.2 bits (95), Expect(2) = 2e-07 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +3 Query: 102 VLAEARSIKVGPPPPPSGGL 161 VLA+A+SIK+GPPPPPSGGL Sbjct: 85 VLADAKSIKLGPPPPPSGGL 104 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 18/32 (56%), Positives = 27/32 (84%) Frame = +2 Query: 2 IPSNSRMAVSRASFTVRSQQVSSESDAMAQSS 97 + N+R+AVSR+ FTVR+QQ SS+S++ +QSS Sbjct: 33 VHGNNRLAVSRSGFTVRAQQASSDSESASQSS 64 >ref|XP_012450948.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like [Gossypium raimondii] gi|763799647|gb|KJB66602.1| hypothetical protein B456_010G146500 [Gossypium raimondii] Length = 231 Score = 43.5 bits (101), Expect(2) = 7e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 102 VLAEARSIKVGPPPPPSGGL 161 VLA+ARSIKVGPPPPPSGGL Sbjct: 81 VLADARSIKVGPPPPPSGGL 100 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +2 Query: 2 IPSNSRMAVSRASFTVRSQQVSSESD 79 IPSN+R+AV R+ FTVR+ Q +E + Sbjct: 33 IPSNNRVAVGRSGFTVRAHQTPAEPE 58 >gb|KHG11453.1| Oxygen-evolving enhancer 3, chloroplastic [Gossypium arboreum] Length = 231 Score = 43.5 bits (101), Expect(2) = 7e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +3 Query: 102 VLAEARSIKVGPPPPPSGGL 161 VLA+ARSIKVGPPPPPSGGL Sbjct: 81 VLADARSIKVGPPPPPSGGL 100 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +2 Query: 2 IPSNSRMAVSRASFTVRSQQVSSESD 79 IPSN+R+AV R+ FTVR+ Q +E + Sbjct: 33 IPSNNRVAVGRSGFTVRAHQTPAEPE 58 >ref|XP_006467954.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like [Citrus sinensis] Length = 233 Score = 39.3 bits (90), Expect(2) = 9e-06 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +3 Query: 102 VLAEARSIKVGPPPPPSGGL 161 VLA+A IKVGPPPPPSGGL Sbjct: 83 VLADATPIKVGPPPPPSGGL 102 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +2 Query: 5 PSNSRMAVSRASFTVRSQQVSSESD 79 PSNSR+AV+R+ FTVR+QQ S+E + Sbjct: 36 PSNSRVAVARSGFTVRAQQASNEPE 60