BLASTX nr result
ID: Aconitum23_contig00005595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00005595 (393 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010691511.1| PREDICTED: DUF21 domain-containing protein A... 65 3e-08 ref|XP_012569759.1| PREDICTED: LOW QUALITY PROTEIN: DUF21 domain... 64 4e-08 ref|XP_004289723.1| PREDICTED: DUF21 domain-containing protein A... 64 4e-08 gb|KJB32810.1| hypothetical protein B456_005G262700 [Gossypium r... 64 6e-08 gb|KJB32809.1| hypothetical protein B456_005G262700 [Gossypium r... 64 6e-08 ref|XP_012480584.1| PREDICTED: DUF21 domain-containing protein A... 64 6e-08 gb|KHG13186.1| DUF21 domain-containing -like protein [Gossypium ... 64 6e-08 emb|CBI25086.3| unnamed protein product [Vitis vinifera] 64 6e-08 ref|XP_002272975.2| PREDICTED: DUF21 domain-containing protein A... 64 6e-08 gb|KRH49888.1| hypothetical protein GLYMA_07G185800 [Glycine max] 63 1e-07 gb|KRH42014.1| hypothetical protein GLYMA_08G063400 [Glycine max] 63 1e-07 gb|KRH42013.1| hypothetical protein GLYMA_08G063400 [Glycine max] 63 1e-07 emb|CDO97330.1| unnamed protein product [Coffea canephora] 63 1e-07 ref|XP_013462434.1| magnesium and cobalt efflux protein CorC, pu... 63 1e-07 ref|XP_013462433.1| magnesium and cobalt efflux protein CorC, pu... 63 1e-07 ref|XP_003531004.1| PREDICTED: DUF21 domain-containing protein A... 63 1e-07 ref|XP_003529278.1| PREDICTED: DUF21 domain-containing protein A... 63 1e-07 ref|XP_003593351.1| magnesium and cobalt efflux protein CorC, pu... 63 1e-07 gb|KDO67912.1| hypothetical protein CISIN_1g014094mg [Citrus sin... 62 1e-07 gb|KDO67910.1| hypothetical protein CISIN_1g014094mg [Citrus sin... 62 1e-07 >ref|XP_010691511.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Beta vulgaris subsp. vulgaris] gi|870848694|gb|KMT00983.1| hypothetical protein BVRB_9g222460 [Beta vulgaris subsp. vulgaris] Length = 428 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVVR Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVR 67 >ref|XP_012569759.1| PREDICTED: LOW QUALITY PROTEIN: DUF21 domain-containing protein At2g14520-like [Cicer arietinum] Length = 422 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVVR Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVR 67 >ref|XP_004289723.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Fragaria vesca subsp. vesca] Length = 425 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLSIVDLEVLAKSG PKDRKHAEKILPVVR Sbjct: 35 GLMSLSIVDLEVLAKSGKPKDRKHAEKILPVVR 67 >gb|KJB32810.1| hypothetical protein B456_005G262700 [Gossypium raimondii] Length = 478 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 67 >gb|KJB32809.1| hypothetical protein B456_005G262700 [Gossypium raimondii] Length = 374 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 67 >ref|XP_012480584.1| PREDICTED: DUF21 domain-containing protein At2g14520-like isoform X1 [Gossypium raimondii] gi|763765552|gb|KJB32806.1| hypothetical protein B456_005G262700 [Gossypium raimondii] Length = 425 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 67 >gb|KHG13186.1| DUF21 domain-containing -like protein [Gossypium arboreum] Length = 425 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 67 >emb|CBI25086.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 7 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 39 >ref|XP_002272975.2| PREDICTED: DUF21 domain-containing protein At2g14520 [Vitis vinifera] gi|147815300|emb|CAN61244.1| hypothetical protein VITISV_016135 [Vitis vinifera] Length = 430 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHAEKILPVV+ Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAEKILPVVK 67 >gb|KRH49888.1| hypothetical protein GLYMA_07G185800 [Glycine max] Length = 397 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >gb|KRH42014.1| hypothetical protein GLYMA_08G063400 [Glycine max] Length = 327 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >gb|KRH42013.1| hypothetical protein GLYMA_08G063400 [Glycine max] Length = 396 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >emb|CDO97330.1| unnamed protein product [Coffea canephora] Length = 427 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >ref|XP_013462434.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] gi|657396489|gb|KEH36469.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] Length = 276 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >ref|XP_013462433.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] gi|657396488|gb|KEH36468.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] Length = 324 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >ref|XP_003531004.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] gi|734432228|gb|KHN46217.1| DUF21 domain-containing protein [Glycine soja] gi|947093427|gb|KRH42012.1| hypothetical protein GLYMA_08G063400 [Glycine max] Length = 425 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >ref|XP_003529278.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] gi|947101397|gb|KRH49889.1| hypothetical protein GLYMA_07G185800 [Glycine max] gi|947101398|gb|KRH49890.1| hypothetical protein GLYMA_07G185800 [Glycine max] gi|947101399|gb|KRH49891.1| hypothetical protein GLYMA_07G185800 [Glycine max] Length = 425 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >ref|XP_003593351.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] gi|355482399|gb|AES63602.1| magnesium and cobalt efflux protein CorC, putative [Medicago truncatula] Length = 429 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMSLS+VDLEVLAKSGTP+DRKHAEKILPVV+ Sbjct: 35 GLMSLSLVDLEVLAKSGTPQDRKHAEKILPVVK 67 >gb|KDO67912.1| hypothetical protein CISIN_1g014094mg [Citrus sinensis] Length = 227 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHA KILPVVR Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVR 67 >gb|KDO67910.1| hypothetical protein CISIN_1g014094mg [Citrus sinensis] gi|641849036|gb|KDO67911.1| hypothetical protein CISIN_1g014094mg [Citrus sinensis] Length = 258 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 293 GLMSLSIVDLEVLAKSGTPKDRKHAEKILPVVR 391 GLMS+S+VDLEVLAKSGTPKDRKHA KILPVVR Sbjct: 35 GLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVR 67