BLASTX nr result
ID: Aconitum23_contig00002608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00002608 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 96 8e-18 gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] 95 2e-17 gb|AHF27221.1| H-type thioredoxin [Hevea brasiliensis] 94 3e-17 ref|XP_002310830.2| thioredoxin h family protein [Populus tricho... 94 3e-17 gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] 94 5e-17 ref|NP_001295646.1| thioredoxin H1-like [Jatropha curcas] gi|315... 94 5e-17 ref|XP_009789451.1| PREDICTED: thioredoxin H-type 2 [Nicotiana s... 93 7e-17 ref|XP_009599959.1| PREDICTED: thioredoxin H-type 2-like [Nicoti... 93 7e-17 ref|XP_007046793.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cac... 93 7e-17 gb|AEC03320.1| thioredoxin H-type 5 [Hevea brasiliensis] 93 7e-17 ref|XP_009628699.1| PREDICTED: thioredoxin H-type 2 [Nicotiana t... 93 9e-17 ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citr... 93 9e-17 ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Caps... 93 9e-17 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 93 9e-17 ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citr... 93 9e-17 ref|XP_009778392.1| PREDICTED: thioredoxin H-type [Nicotiana syl... 92 1e-16 ref|XP_008361428.1| PREDICTED: thioredoxin H-type [Malus domestica] 92 1e-16 ref|XP_008338022.1| PREDICTED: thioredoxin H-type-like [Malus do... 92 1e-16 ref|XP_013602897.1| PREDICTED: thioredoxin H1 [Brassica oleracea... 92 2e-16 ref|XP_009115785.1| PREDICTED: thioredoxin H1 isoform X2 [Brassi... 92 2e-16 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 96.3 bits (238), Expect = 8e-18 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKHA 219 +LKVDVDELKTVA DWAVEAMPTFMFLKEGKI+DKVVGAKKE+LQ IAKHA Sbjct: 61 FLKVDVDELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHA 112 >gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] Length = 118 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKHA 219 +LKVDVDELKTVA DWAV+AMPTFMFLKEGKI+DKVVGAKKE+LQ IAKHA Sbjct: 61 FLKVDVDELKTVAEDWAVKAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHA 112 >gb|AHF27221.1| H-type thioredoxin [Hevea brasiliensis] Length = 117 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -1 Query: 371 LKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKHA 219 LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVGAKKE+L+S IAKHA Sbjct: 62 LKVDVDELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELESTIAKHA 112 >ref|XP_002310830.2| thioredoxin h family protein [Populus trichocarpa] gi|743839194|ref|XP_011025882.1| PREDICTED: thioredoxin H-type [Populus euphratica] gi|118481453|gb|ABK92669.1| unknown [Populus trichocarpa] gi|550334812|gb|EEE91280.2| thioredoxin h family protein [Populus trichocarpa] Length = 122 Score = 94.4 bits (233), Expect = 3e-17 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELKTVA DWAVEAMPTFMFLKEGKIVDKVVGA+K++LQ AIAKH Sbjct: 62 FLKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGARKDELQQAIAKH 112 >gb|AEC03322.1| thioredoxin H-type 7 [Hevea brasiliensis] Length = 118 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVD+DELKTVA DWAVEAMPTFMFLKEGKI+DKVVGAKKE+LQ IAKH Sbjct: 61 FLKVDLDELKTVAEDWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKH 111 >ref|NP_001295646.1| thioredoxin H1-like [Jatropha curcas] gi|315937256|gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] gi|643731230|gb|KDP38568.1| hypothetical protein JCGZ_04493 [Jatropha curcas] Length = 118 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKHA 219 +LKVDVDEL+TVA DWAVEAMPTFMFLKEGKIVDKVVGAKKE+LQ I KHA Sbjct: 61 FLKVDVDELRTVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQMTIVKHA 112 >ref|XP_009789451.1| PREDICTED: thioredoxin H-type 2 [Nicotiana sylvestris] Length = 118 Score = 93.2 bits (230), Expect = 7e-17 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA+DWAVEAMPTFMFLKEGKIVDKVVGAKK++LQ IAKH Sbjct: 61 FLKVDVDELKSVASDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111 >ref|XP_009599959.1| PREDICTED: thioredoxin H-type 2-like [Nicotiana tomentosiformis] Length = 117 Score = 93.2 bits (230), Expect = 7e-17 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEG IVDKVVGAKKE+LQ AIAKH Sbjct: 61 FLKVDVDELKSVATDWAVEAMPTFMFLKEGDIVDKVVGAKKEELQQAIAKH 111 >ref|XP_007046793.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] gi|508699054|gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 93.2 bits (230), Expect = 7e-17 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK VA DWAVEAMPTFMFLKEGKIVDKVVGAKK+DLQ +AKH Sbjct: 62 FLKVDVDELKEVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDDLQQTVAKH 112 >gb|AEC03320.1| thioredoxin H-type 5 [Hevea brasiliensis] Length = 117 Score = 93.2 bits (230), Expect = 7e-17 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKHA 219 +LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVGAKKE+L+ IAKHA Sbjct: 61 FLKVDVDELKSVAEDWAVEAMPTFMFLKEGKIVDKVVGAKKEELELTIAKHA 112 >ref|XP_009628699.1| PREDICTED: thioredoxin H-type 2 [Nicotiana tomentosiformis] Length = 118 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVGAKK++LQ IAKH Sbjct: 61 FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111 >ref|XP_006425592.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|557527582|gb|ESR38832.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] Length = 120 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVG+KKE+LQ IAKH Sbjct: 64 FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKH 114 >ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] gi|482561483|gb|EOA25674.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] Length = 114 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVD+DELK+VA+DWA+EAMPTFMFLKEGKI+DKVVGAKK++LQS IAKH Sbjct: 62 FLKVDIDELKSVASDWAIEAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVGAKK++LQ IAKH Sbjct: 61 FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111 >ref|XP_006425591.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|568824998|ref|XP_006466877.1| PREDICTED: thioredoxin H-type-like [Citrus sinensis] gi|119367477|gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] gi|557527581|gb|ESR38831.1| hypothetical protein CICLE_v10026781mg [Citrus clementina] gi|641852190|gb|KDO71055.1| hypothetical protein CISIN_1g033426mg [Citrus sinensis] Length = 119 Score = 92.8 bits (229), Expect = 9e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEGKIVDKVVG+KKE+LQ IAKH Sbjct: 63 FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKH 113 >ref|XP_009778392.1| PREDICTED: thioredoxin H-type [Nicotiana sylvestris] Length = 117 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVDVDELK+VA DWAVEAMPTFMFLKEG IVDKVVGAKK++LQ AIAKH Sbjct: 61 FLKVDVDELKSVATDWAVEAMPTFMFLKEGNIVDKVVGAKKDELQQAIAKH 111 >ref|XP_008361428.1| PREDICTED: thioredoxin H-type [Malus domestica] Length = 118 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 ++KVDVDELKTVA DWAVEAMPTFMFLKEGKIVDKVVGAKK++LQ IAKH Sbjct: 62 FVKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQXTIAKH 112 >ref|XP_008338022.1| PREDICTED: thioredoxin H-type-like [Malus domestica] Length = 118 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 ++KVDVDELKTVA DWAVEAMPTFMFLKEGKIVDKVVGAKK++LQ IAKH Sbjct: 62 FVKVDVDELKTVAQDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQRTIAKH 112 >ref|XP_013602897.1| PREDICTED: thioredoxin H1 [Brassica oleracea var. oleracea] gi|923810619|ref|XP_013690776.1| PREDICTED: thioredoxin H1-like [Brassica napus] Length = 114 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/51 (80%), Positives = 50/51 (98%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVD+DELK+VA+DWA+E+MPTFMF+KEGKIVDKVVGAKK++LQS IAKH Sbjct: 62 FLKVDIDELKSVASDWAIESMPTFMFMKEGKIVDKVVGAKKDELQSTIAKH 112 >ref|XP_009115785.1| PREDICTED: thioredoxin H1 isoform X2 [Brassica rapa] Length = 94 Score = 92.0 bits (227), Expect = 2e-16 Identities = 41/51 (80%), Positives = 50/51 (98%) Frame = -1 Query: 374 YLKVDVDELKTVAADWAVEAMPTFMFLKEGKIVDKVVGAKKEDLQSAIAKH 222 +LKVD+DELK+VA+DWA+E+MPTFMF+KEGKIVDKVVGAKK++LQS IAKH Sbjct: 42 FLKVDIDELKSVASDWAIESMPTFMFMKEGKIVDKVVGAKKDELQSTIAKH 92