BLASTX nr result
ID: Aconitum23_contig00001456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00001456 (373 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518192.1| myosin XI, putative [Ricinus communis] gi|22... 58 2e-06 >ref|XP_002518192.1| myosin XI, putative [Ricinus communis] gi|223542788|gb|EEF44325.1| myosin XI, putative [Ricinus communis] Length = 1487 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/38 (63%), Positives = 36/38 (94%) Frame = -1 Query: 340 NIPFTVDDISTSLQDNNFSNIKLDTELLKNPEFEFLQE 227 +IPFTV+++S+SLQDN+FS++KL +LL+NP+F+FLQE Sbjct: 1450 SIPFTVEEVSSSLQDNDFSHVKLAPDLLENPDFQFLQE 1487