BLASTX nr result
ID: Aconitum21_contig00026643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00026643 (865 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] 47 5e-06 >gb|ADP20179.1| gag-pol polyprotein [Silene latifolia] Length = 1475 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = -3 Query: 509 NPKPYLLGWLMKESETIVTHQCTFRFALHEKFIDEVTCDIVPLEIFQAILG 357 +P PY L WL K +E V QC F++ + + DE CD++P++ +LG Sbjct: 428 HPSPYKLRWLNKGAEVRVDKQCLVTFSIGKNYSDEALCDVLPMDACHLLLG 478 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -1 Query: 646 MDHREQLFSIKLQVKTSLMNVIIDFRYKKNLIYKGLVDRLGL 521 MD R+Q+F + +K + N+IID N+ L+++L L Sbjct: 382 MDQRQQIFRSRCTIKGRVCNLIIDGGSCTNVASSTLIEKLSL 423