BLASTX nr result
ID: Aconitum21_contig00026585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00026585 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170411.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 58 9e-07 ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein... 58 9e-07 emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera] 56 3e-06 ref|XP_002520669.1| protein binding protein, putative [Ricinus c... 56 3e-06 ref|XP_003553644.1| PREDICTED: BTB/POZ domain-containing protein... 55 5e-06 >ref|XP_004170411.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g03010-like [Cucumis sativus] Length = 675 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 217 VFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 321 VF MGV T AELKP +SGKR+FRPSSSIRHA EW Sbjct: 40 VFFRMGVVTVAELKPSISGKRSFRPSSSIRHATEW 74 >ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Cucumis sativus] Length = 675 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 217 VFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 321 VF MGV T AELKP +SGKR+FRPSSSIRHA EW Sbjct: 40 VFFRMGVVTVAELKPSISGKRSFRPSSSIRHATEW 74 >emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera] Length = 1388 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 217 VFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 321 VF+ MGV T ELKP +SGKR+FRPSSS RHA EW Sbjct: 653 VFEKMGVVTVGELKPSISGKRSFRPSSSTRHATEW 687 >ref|XP_002520669.1| protein binding protein, putative [Ricinus communis] gi|223540054|gb|EEF41631.1| protein binding protein, putative [Ricinus communis] Length = 631 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 229 MGVATFAELKPGMSGKRAFRPSSSIRHAVEW 321 MGV T AELKP +SGKR+FRPSSSIRHA EW Sbjct: 1 MGVVTVAELKPSISGKRSFRPSSSIRHATEW 31 >ref|XP_003553644.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Glycine max] Length = 651 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 205 LNCKVFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 321 L K MGV T ELKP +SGKR FRPSSSIRHA EW Sbjct: 16 LKFKELSHMGVVTVGELKPSISGKRTFRPSSSIRHATEW 54