BLASTX nr result
ID: Aconitum21_contig00024838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00024838 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 174 5e-42 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 174 5e-42 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 174 5e-42 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 174 9e-42 ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containi... 173 1e-41 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 174 bits (442), Expect = 5e-42 Identities = 78/96 (81%), Positives = 91/96 (94%) Frame = -3 Query: 434 KKEGYIPDTDYILLDVEEEDKERALYYHSEKLAIAYGLISTPPSATIRVIKNLRVCGDCH 255 +++GY+PDT+++LLDVE+E+KER+LYYHSEKLAIAYGLISTP S TIRVIKNLRVCGDCH Sbjct: 1485 REDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVCGDCH 1544 Query: 254 NAIKYISRVVDREIVLRDANRFHCFRNGNCSCGDYW 147 NAIKYIS+V +REIVLRDANRFH FR+G CSCGDYW Sbjct: 1545 NAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 1580 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 174 bits (442), Expect = 5e-42 Identities = 78/96 (81%), Positives = 91/96 (94%) Frame = -3 Query: 434 KKEGYIPDTDYILLDVEEEDKERALYYHSEKLAIAYGLISTPPSATIRVIKNLRVCGDCH 255 +++GY+PDT+++LLDVE+E+KER+LYYHSEKLAIAYGLISTP S TIRVIKNLRVCGDCH Sbjct: 770 REDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVCGDCH 829 Query: 254 NAIKYISRVVDREIVLRDANRFHCFRNGNCSCGDYW 147 NAIKYIS+V +REIVLRDANRFH FR+G CSCGDYW Sbjct: 830 NAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 865 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 174 bits (442), Expect = 5e-42 Identities = 78/96 (81%), Positives = 91/96 (94%) Frame = -3 Query: 434 KKEGYIPDTDYILLDVEEEDKERALYYHSEKLAIAYGLISTPPSATIRVIKNLRVCGDCH 255 +++GY+PDT+++LLDVE+E+KER+LYYHSEKLAIAYGLISTP S TIRVIKNLRVCGDCH Sbjct: 408 REDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVCGDCH 467 Query: 254 NAIKYISRVVDREIVLRDANRFHCFRNGNCSCGDYW 147 NAIKYIS+V +REIVLRDANRFH FR+G CSCGDYW Sbjct: 468 NAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 503 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 174 bits (440), Expect = 9e-42 Identities = 77/96 (80%), Positives = 90/96 (93%) Frame = -3 Query: 434 KKEGYIPDTDYILLDVEEEDKERALYYHSEKLAIAYGLISTPPSATIRVIKNLRVCGDCH 255 K+EGY+P+TD+ L+DVEEE+KERALYYHSEKLA+A+GL+STPPS IRVIKNLRVCGDCH Sbjct: 902 KQEGYVPETDFTLVDVEEEEKERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCH 961 Query: 254 NAIKYISRVVDREIVLRDANRFHCFRNGNCSCGDYW 147 NA+KYIS+V DREIVLRDANRFH F++G CSCGDYW Sbjct: 962 NAMKYISKVYDREIVLRDANRFHRFKDGICSCGDYW 997 >ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1582 Score = 173 bits (438), Expect = 1e-41 Identities = 77/96 (80%), Positives = 89/96 (92%) Frame = -3 Query: 434 KKEGYIPDTDYILLDVEEEDKERALYYHSEKLAIAYGLISTPPSATIRVIKNLRVCGDCH 255 ++EGY+PDTD+ L+DVEEEDKE +LYYHSEKLAIAYGL+ TPPS T+RVIKNLRVCGDCH Sbjct: 1487 REEGYLPDTDFALVDVEEEDKECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCH 1546 Query: 254 NAIKYISRVVDREIVLRDANRFHCFRNGNCSCGDYW 147 NAIKYIS+V +RE+VLRDANRFH FR+G CSCGDYW Sbjct: 1547 NAIKYISKVFEREVVLRDANRFHHFRSGVCSCGDYW 1582