BLASTX nr result
ID: Aconitum21_contig00024810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00024810 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279534.2| PREDICTED: putative Peroxidase 48-like [Viti... 64 1e-08 ref|XP_002516056.1| Peroxidase 57 precursor, putative [Ricinus c... 62 4e-08 ref|XP_002298218.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_002269658.2| PREDICTED: putative Peroxidase 48 [Vitis vin... 59 4e-07 emb|CBI27430.3| unnamed protein product [Vitis vinifera] 59 4e-07 >ref|XP_002279534.2| PREDICTED: putative Peroxidase 48-like [Vitis vinifera] gi|297743272|emb|CBI36139.3| unnamed protein product [Vitis vinifera] Length = 404 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 241 ESDFYRNSSPQAEKIVRSIIQMLCVKQTNVAPALLRLVFHDCFIQ 107 E DFYRNS P AE+I+R++I+ L + NVAPALLRLVFHDCFI+ Sbjct: 72 EYDFYRNSCPPAEQIIRTMIRRLYEVRPNVAPALLRLVFHDCFIE 116 >ref|XP_002516056.1| Peroxidase 57 precursor, putative [Ricinus communis] gi|223544961|gb|EEF46476.1| Peroxidase 57 precursor, putative [Ricinus communis] Length = 437 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 241 ESDFYRNSSPQAEKIVRSIIQMLCVKQTNVAPALLRLVFHDCFI 110 E DFYRNS PQAEKI++++++ L + +V+PALLRLVFHDCFI Sbjct: 77 EYDFYRNSCPQAEKIIQNVVRELYKVKFSVSPALLRLVFHDCFI 120 >ref|XP_002298218.1| predicted protein [Populus trichocarpa] gi|222845476|gb|EEE83023.1| predicted protein [Populus trichocarpa] Length = 309 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -3 Query: 241 ESDFYRNSSPQAEKIVRSIIQMLCVKQTNVAPALLRLVFHDCFIQ 107 E DFYR+S P+AE+I+R ++ L ++VAPALLRLVFHDCFI+ Sbjct: 17 EYDFYRDSCPEAERIIRRVVHELYEVNSSVAPALLRLVFHDCFIE 61 >ref|XP_002269658.2| PREDICTED: putative Peroxidase 48 [Vitis vinifera] Length = 381 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -3 Query: 241 ESDFYRNSSPQAEKIVRSIIQMLCVKQTNVAPALLRLVFHDCFIQ 107 E DFYRNS P+AE IVRS + + ++ PALLRL+FHDCFIQ Sbjct: 55 EYDFYRNSCPKAESIVRSSMAQIFAAHSDTPPALLRLLFHDCFIQ 99 >emb|CBI27430.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -3 Query: 241 ESDFYRNSSPQAEKIVRSIIQMLCVKQTNVAPALLRLVFHDCFIQ 107 E DFYRNS P+AE IVRS + + ++ PALLRL+FHDCFIQ Sbjct: 49 EYDFYRNSCPKAESIVRSSMAQIFAAHSDTPPALLRLLFHDCFIQ 93