BLASTX nr result
ID: Aconitum21_contig00024569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00024569 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513297.1| strubbelig receptor, putative [Ricinus commu... 58 7e-07 ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 56 3e-06 >ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis] gi|223547205|gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis] Length = 694 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 384 PPMSEVVQALVRLVQRSNMNMRDDLSASRRTDASD 280 PPMSEVVQALVRLVQRS+M MRDDL+AS RT+ SD Sbjct: 659 PPMSEVVQALVRLVQRSSMKMRDDLAASVRTEESD 693 >ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis sativus] gi|449496770|ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis sativus] Length = 662 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 384 PPMSEVVQALVRLVQRSNMNMRDDLSASRRTDASDQDY 271 PPMSEVVQALV LVQRS+MNMRDDL SRR D D DY Sbjct: 627 PPMSEVVQALVTLVQRSSMNMRDDLGNSRRMD--DYDY 662