BLASTX nr result
ID: Aconitum21_contig00024568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00024568 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299762.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 tpg|DAA54733.1| TPA: hypothetical protein ZEAMMB73_341521 [Zea m... 59 5e-07 ref|XP_003632213.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 5e-07 emb|CBI24406.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002442564.1| hypothetical protein SORBIDRAFT_08g022020 [S... 59 5e-07 >ref|XP_002299762.1| predicted protein [Populus trichocarpa] gi|222847020|gb|EEE84567.1| predicted protein [Populus trichocarpa] Length = 624 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 WYDFDDSHVFPISGDKIKTSSAYVLFYRRV 90 WYDFDDSHV PIS +KIKTS+AYVLFYRRV Sbjct: 594 WYDFDDSHVSPISQEKIKTSAAYVLFYRRV 623 >tpg|DAA54733.1| TPA: hypothetical protein ZEAMMB73_341521 [Zea mays] Length = 888 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 WYDFDDSHVFPISGDKIKTSSAYVLFYRRVQE 96 WYDFDD HV PI+ D IKTS+AYVLFYRR+QE Sbjct: 842 WYDFDDRHVGPITEDSIKTSAAYVLFYRRIQE 873 >ref|XP_003632213.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 8-like [Vitis vinifera] Length = 882 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 WYDFDDSHVFPISGDKIKTSSAYVLFYRRV 90 WYDFDDSHV PI DKIKTS+AYVLFYRRV Sbjct: 850 WYDFDDSHVSPIPEDKIKTSAAYVLFYRRV 879 >emb|CBI24406.3| unnamed protein product [Vitis vinifera] Length = 921 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 WYDFDDSHVFPISGDKIKTSSAYVLFYRRV 90 WYDFDDSHV PI DKIKTS+AYVLFYRRV Sbjct: 889 WYDFDDSHVSPIPEDKIKTSAAYVLFYRRV 918 >ref|XP_002442564.1| hypothetical protein SORBIDRAFT_08g022020 [Sorghum bicolor] gi|241943257|gb|EES16402.1| hypothetical protein SORBIDRAFT_08g022020 [Sorghum bicolor] Length = 890 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 WYDFDDSHVFPISGDKIKTSSAYVLFYRRVQE 96 WYDFDD HV PI+ D IKTS+AYVLFYRR+QE Sbjct: 844 WYDFDDRHVGPITEDSIKTSAAYVLFYRRIQE 875