BLASTX nr result
ID: Aconitum21_contig00023433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023433 (735 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305687.1| predicted protein [Populus trichocarpa] gi|2... 57 5e-06 ref|XP_002519031.1| conserved hypothetical protein [Ricinus comm... 56 7e-06 >ref|XP_002305687.1| predicted protein [Populus trichocarpa] gi|222848651|gb|EEE86198.1| predicted protein [Populus trichocarpa] Length = 344 Score = 56.6 bits (135), Expect = 5e-06 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +2 Query: 179 KW--WLQLRKACLSIVSHEYASVIVRKASGNFKETL*ELGGLDAVFEV 316 KW L + KACLS +S E S +VRK GNFKE L ELGGLDAVFEV Sbjct: 288 KWIALLSMEKACLSKISFEDTSGMVRKTGGNFKEKLRELGGLDAVFEV 335 >ref|XP_002519031.1| conserved hypothetical protein [Ricinus communis] gi|223541694|gb|EEF43242.1| conserved hypothetical protein [Ricinus communis] Length = 905 Score = 56.2 bits (134), Expect = 7e-06 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Frame = +2 Query: 179 KW--WLQLRKACLSIVSHEYASVIVRKASGNFKETL*ELGGLDAVFEVPKESFYIREVVI 352 KW L + KACLS +S E S +VRK GNFKE L ELGGLDA+FEV + + + Sbjct: 308 KWIALLTMEKACLSKISFEDTSGMVRKTGGNFKEKLRELGGLDAIFEV---AVHCHSTME 364 Query: 353 PWCSILPGTL 382 W P T+ Sbjct: 365 SWTGHGPSTM 374