BLASTX nr result
ID: Aconitum21_contig00023338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00023338 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513134.1| conserved hypothetical protein [Ricinus comm... 73 3e-11 >ref|XP_002513134.1| conserved hypothetical protein [Ricinus communis] gi|223548145|gb|EEF49637.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 221 ALECGRQRFRSLYWRVRAEIKRRHEAKKQRFSSFHYDPFSYALNFDNANSGFFC 382 AL G+++FRSL+WRVRAEI+R+ + + ++ SF YDP SYALNFDN N GF C Sbjct: 13 ALLWGKRKFRSLFWRVRAEIRRQMKRRSKQRFSFQYDPLSYALNFDNGNFGFLC 66