BLASTX nr result
ID: Aconitum21_contig00022929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00022929 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA53485.1| TPA: hypothetical protein ZEAMMB73_494075 [Zea m... 98 6e-19 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago ... 97 1e-18 ref|NP_567948.1| pentatricopeptide repeat-containing protein [Ar... 97 2e-18 ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] g... 97 2e-18 >tpg|DAA53485.1| TPA: hypothetical protein ZEAMMB73_494075 [Zea mays] Length = 830 Score = 98.2 bits (243), Expect = 6e-19 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 409 IRITKNLRVCGDCHEAAKYISKITDREIIIRDTNRFHHFRNGVCSCRDYW 260 IRITKNLR+C DCH K+ISK TDREI++RD NRFHHFRNGVCSCRDYW Sbjct: 781 IRITKNLRLCEDCHSVTKFISKFTDREIVVRDVNRFHHFRNGVCSCRDYW 830 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Glycine max] Length = 824 Score = 97.4 bits (241), Expect = 1e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 409 IRITKNLRVCGDCHEAAKYISKITDREIIIRDTNRFHHFRNGVCSCRDYW 260 IRI KNLRVCGDCH A KYISKIT+REII+RD+NRFHHF++G+CSC DYW Sbjct: 775 IRIFKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGICSCGDYW 824 >ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago truncatula] gi|355522693|gb|AET03147.1| hypothetical protein MTR_8g063290 [Medicago truncatula] Length = 659 Score = 97.4 bits (241), Expect = 1e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 409 IRITKNLRVCGDCHEAAKYISKITDREIIIRDTNRFHHFRNGVCSCRDYW 260 IRITKNLRVCGDCH AAK ISKI +REII+RDTNRFHHF++GVCSC DYW Sbjct: 610 IRITKNLRVCGDCHIAAKLISKIVEREIIVRDTNRFHHFKDGVCSCGDYW 659 >ref|NP_567948.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635622|sp|O81767.2|PP348_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33990; AltName: Full=Protein EMBRYO DEFECTIVE 2758 gi|332660906|gb|AEE86306.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 823 Score = 96.7 bits (239), Expect = 2e-18 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 409 IRITKNLRVCGDCHEAAKYISKITDREIIIRDTNRFHHFRNGVCSCRDYW 260 IRI KNLRVCGDCH K+ISKIT+REII+RD+NRFHHF+NGVCSC DYW Sbjct: 774 IRIFKNLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 823 >ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] gi|297312975|gb|EFH43398.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] Length = 824 Score = 96.7 bits (239), Expect = 2e-18 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 409 IRITKNLRVCGDCHEAAKYISKITDREIIIRDTNRFHHFRNGVCSCRDYW 260 IRI KNLRVCGDCH K+ISKIT+REII+RD+NRFHHF+NGVCSC DYW Sbjct: 775 IRIFKNLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 824