BLASTX nr result
ID: Aconitum21_contig00022469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00022469 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269725.2| PREDICTED: monocopper oxidase-like protein S... 64 1e-08 ref|XP_004163159.1| PREDICTED: monocopper oxidase-like protein S... 56 3e-06 ref|XP_004148963.1| PREDICTED: monocopper oxidase-like protein S... 56 3e-06 ref|XP_003568969.1| PREDICTED: monocopper oxidase-like protein S... 55 5e-06 gb|ACN40384.1| unknown [Picea sitchensis] 55 5e-06 >ref|XP_002269725.2| PREDICTED: monocopper oxidase-like protein SKU5-like [Vitis vinifera] gi|297742831|emb|CBI35585.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +1 Query: 1 YISVVNPEITNKTELGLPDNAIYCGLLSYLQRYQAHKVSFSG 126 Y++VVNPEIT+KTEL LPDNAIYCG+LS LQ+ ++ +V FSG Sbjct: 528 YVNVVNPEITDKTELPLPDNAIYCGVLSSLQKDRSQRVRFSG 569 >ref|XP_004163159.1| PREDICTED: monocopper oxidase-like protein SKU5-like, partial [Cucumis sativus] Length = 372 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 1 YISVVNPEITNKTELGLPDNAIYCGLLSYLQRYQAHKVSFSGTTA 135 Y+SVVNPEI +K+E+ +PDN IYCGLLS LQ+ Q+ + FSG + Sbjct: 307 YVSVVNPEI-DKSEIPMPDNTIYCGLLSSLQKDQSQRFKFSGAAS 350 >ref|XP_004148963.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cucumis sativus] Length = 595 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 1 YISVVNPEITNKTELGLPDNAIYCGLLSYLQRYQAHKVSFSGTTA 135 Y+SVVNPEI +K+E+ +PDN IYCGLLS LQ+ Q+ + FSG + Sbjct: 530 YVSVVNPEI-DKSEIPMPDNTIYCGLLSSLQKDQSQRFKFSGAAS 573 >ref|XP_003568969.1| PREDICTED: monocopper oxidase-like protein SKU5-like isoform 1 [Brachypodium distachyon] Length = 597 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +1 Query: 1 YISVVNPE-ITNKTELGLPDNAIYCGLLSYLQRYQAHKVSFSGTTAV 138 YISVVNPE ++KT L LPDN I+CG LS LQ+ Q+H+ +SG ++V Sbjct: 532 YISVVNPEDSSDKTVLPLPDNTIFCGALSSLQKEQSHRFQYSGASSV 578 >gb|ACN40384.1| unknown [Picea sitchensis] Length = 591 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 1 YISVVNPEITNKTELGLPDNAIYCGLLSYLQRYQAH 108 Y+ VVNPEI NKTEL LP NA+YCG LS +Q+ Q+H Sbjct: 525 YVRVVNPEINNKTELPLPSNALYCGALSRMQKPQSH 560