BLASTX nr result
ID: Aconitum21_contig00022359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00022359 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530876.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 gb|AEC11000.1| hypothetical protein [Camellia sinensis] 63 3e-08 ref|XP_003524945.1| PREDICTED: uncharacterized protein LOC100780... 62 4e-08 ref|XP_004142162.1| PREDICTED: uncharacterized protein LOC101215... 62 5e-08 ref|XP_003531235.1| PREDICTED: uncharacterized protein LOC100797... 62 6e-08 >ref|XP_002530876.1| conserved hypothetical protein [Ricinus communis] gi|223529565|gb|EEF31516.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -3 Query: 139 IYETLTYFGLPPGLLPGSVTSYTLDSETGRFTVDLPKPCYLHFDYL 2 +YE L +GLP GLLP SVT+YTL SE GRF V L KPCY+ FDYL Sbjct: 35 VYEILPKYGLPSGLLPNSVTNYTL-SEDGRFVVVLGKPCYIQFDYL 79 >gb|AEC11000.1| hypothetical protein [Camellia sinensis] Length = 173 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 139 IYETLTYFGLPPGLLPGSVTSYTLDSETGRFTVDLPKPCYLHFDYL 2 +YE L FGLP GLLP +V SY+LD + G F VDL KPCY+ FDYL Sbjct: 35 VYEILPKFGLPSGLLPDTVKSYSLDDD-GNFVVDLDKPCYIQFDYL 79 >ref|XP_003524945.1| PREDICTED: uncharacterized protein LOC100780285 [Glycine max] Length = 175 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 139 IYETLTYFGLPPGLLPGSVTSYTLDSETGRFTVDLPKPCYLHFDYL 2 +YE L +GLP GLLP +VT Y LD E G+F V LPKPCY+ FDYL Sbjct: 34 VYEILPKYGLPSGLLPDTVTDYKLD-EDGQFVVVLPKPCYIQFDYL 78 >ref|XP_004142162.1| PREDICTED: uncharacterized protein LOC101215998 [Cucumis sativus] gi|449530349|ref|XP_004172158.1| PREDICTED: uncharacterized protein LOC101227250 [Cucumis sativus] Length = 176 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 139 IYETLTYFGLPPGLLPGSVTSYTLDSETGRFTVDLPKPCYLHFDYL 2 +Y+ L +GLP GLLP SV YTL S+ G+F V L KPCY+HFDYL Sbjct: 33 VYDVLPKYGLPSGLLPDSVLDYTLSSD-GQFVVHLAKPCYIHFDYL 77 >ref|XP_003531235.1| PREDICTED: uncharacterized protein LOC100797337 [Glycine max] Length = 175 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 139 IYETLTYFGLPPGLLPGSVTSYTLDSETGRFTVDLPKPCYLHFDYL 2 +YE L +GLP GLLP +VT YTLD E G+F V L KPCY+ FDYL Sbjct: 34 VYEILPKYGLPSGLLPDTVTDYTLD-EDGQFVVVLAKPCYIQFDYL 78