BLASTX nr result
ID: Aconitum21_contig00022270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00022270 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529337.1| PREDICTED: uncharacterized protein C6G9.01c-... 81 1e-13 ref|XP_003529336.1| PREDICTED: uncharacterized protein C6G9.01c-... 81 1e-13 ref|NP_001235352.1| uncharacterized protein LOC100527386 [Glycin... 80 2e-13 ref|XP_004141309.1| PREDICTED: uncharacterized protein C6G9.01c-... 79 3e-13 ref|XP_002532174.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 >ref|XP_003529337.1| PREDICTED: uncharacterized protein C6G9.01c-like isoform 2 [Glycine max] Length = 137 Score = 80.9 bits (198), Expect = 1e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 319 FVDQPSKPRKRTGDGLVVYSEEELGIGKSDAGGTSLCPFDCSCCF 185 FVD+PS+PRK+T DGL +Y+EEELGI +DAG T LCPFDCSCCF Sbjct: 93 FVDRPSRPRKKTEDGLTIYTEEELGISNADAGNTPLCPFDCSCCF 137 >ref|XP_003529336.1| PREDICTED: uncharacterized protein C6G9.01c-like isoform 1 [Glycine max] Length = 128 Score = 80.9 bits (198), Expect = 1e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 319 FVDQPSKPRKRTGDGLVVYSEEELGIGKSDAGGTSLCPFDCSCCF 185 FVD+PS+PRK+T DGL +Y+EEELGI +DAG T LCPFDCSCCF Sbjct: 84 FVDRPSRPRKKTEDGLTIYTEEELGISNADAGNTPLCPFDCSCCF 128 >ref|NP_001235352.1| uncharacterized protein LOC100527386 [Glycine max] gi|255632232|gb|ACU16474.1| unknown [Glycine max] Length = 126 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 319 FVDQPSKPRKRTGDGLVVYSEEELGIGKSDAGGTSLCPFDCSCCF 185 FVD PS+PRK+T DGL VY+EEELGI +DAG T LCPFDCSCCF Sbjct: 82 FVDLPSRPRKKTEDGLTVYTEEELGISNADAGNTPLCPFDCSCCF 126 >ref|XP_004141309.1| PREDICTED: uncharacterized protein C6G9.01c-like [Cucumis sativus] gi|449486629|ref|XP_004157352.1| PREDICTED: uncharacterized protein C6G9.01c-like isoform 1 [Cucumis sativus] gi|449486633|ref|XP_004157353.1| PREDICTED: uncharacterized protein C6G9.01c-like isoform 2 [Cucumis sativus] Length = 140 Score = 79.3 bits (194), Expect = 3e-13 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 322 GFVDQPSKPRKRTGDGLVVYSEEELGIGKSDAGGTSLCPFDCSCCF 185 GF D S+ RK+TGDGL +Y+EEELG G +DAGGT LCPFDC+CCF Sbjct: 95 GFADPQSRRRKKTGDGLTIYTEEELGFGNADAGGTPLCPFDCNCCF 140 >ref|XP_002532174.1| conserved hypothetical protein [Ricinus communis] gi|223528142|gb|EEF30211.1| conserved hypothetical protein [Ricinus communis] Length = 129 Score = 77.0 bits (188), Expect = 1e-12 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 319 FVDQPSKPRKRTGDGLVVYSEEELGIGKSDAGGTSLCPFDCSCCF 185 F+D PSKPRK+T DG +Y+EEELGI S+ GGT LCPFDC CCF Sbjct: 85 FMDPPSKPRKKTEDGFTIYTEEELGINSSNVGGTPLCPFDCECCF 129