BLASTX nr result
ID: Aconitum21_contig00022268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00022268 (574 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264745.2| PREDICTED: serine/threonine-protein kinase H... 65 8e-09 emb|CBI35506.3| unnamed protein product [Vitis vinifera] 65 8e-09 emb|CAN80049.1| hypothetical protein VITISV_005118 [Vitis vinifera] 65 8e-09 ref|XP_002300929.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 ref|XP_002533015.1| protein kinase, putative [Ricinus communis] ... 62 5e-08 >ref|XP_002264745.2| PREDICTED: serine/threonine-protein kinase HT1-like [Vitis vinifera] Length = 555 Score = 65.1 bits (157), Expect = 8e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 LRPDLPDNAHPRILNLMQRCWETEPGNRPDFSEIT 106 LRPDLP+N HP+++++MQRCWE PGNRP FSEIT Sbjct: 501 LRPDLPENTHPKLVDMMQRCWEAVPGNRPSFSEIT 535 >emb|CBI35506.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 65.1 bits (157), Expect = 8e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 LRPDLPDNAHPRILNLMQRCWETEPGNRPDFSEIT 106 LRPDLP+N HP+++++MQRCWE PGNRP FSEIT Sbjct: 496 LRPDLPENTHPKLVDMMQRCWEAVPGNRPSFSEIT 530 >emb|CAN80049.1| hypothetical protein VITISV_005118 [Vitis vinifera] Length = 444 Score = 65.1 bits (157), Expect = 8e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 LRPDLPDNAHPRILNLMQRCWETEPGNRPDFSEIT 106 LRPDLP+N HP+++++MQRCWE PGNRP FSEIT Sbjct: 368 LRPDLPENTHPKLVDMMQRCWEAVPGNRPSFSEIT 402 >ref|XP_002300929.1| predicted protein [Populus trichocarpa] gi|222842655|gb|EEE80202.1| predicted protein [Populus trichocarpa] Length = 494 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 LRPDLPDNAHPRILNLMQRCWETEPGNRPDFSEIT 106 LRPDLP NAHP++L+LMQRCWET P RP FSEIT Sbjct: 451 LRPDLPQNAHPKLLDLMQRCWETVPDKRPSFSEIT 485 >ref|XP_002533015.1| protein kinase, putative [Ricinus communis] gi|223527204|gb|EEF29369.1| protein kinase, putative [Ricinus communis] Length = 561 Score = 62.4 bits (150), Expect = 5e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 2 LRPDLPDNAHPRILNLMQRCWETEPGNRPDFSEIT 106 LRPDLP AHP++L+LMQRCWET P +RP FSEIT Sbjct: 500 LRPDLPQYAHPKVLHLMQRCWETTPTDRPSFSEIT 534