BLASTX nr result
ID: Aconitum21_contig00020428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00020428 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159766.1| PREDICTED: origin recognition complex subuni... 55 5e-06 ref|XP_004138588.1| PREDICTED: origin recognition complex subuni... 55 5e-06 >ref|XP_004159766.1| PREDICTED: origin recognition complex subunit 5-like [Cucumis sativus] Length = 536 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 379 SRYRSTVSEEMALKVARSVNFPLSKYLYRR 290 +RYRSTVSE+MALKVARS+ FPLSKY+YRR Sbjct: 507 TRYRSTVSEDMALKVARSIKFPLSKYMYRR 536 >ref|XP_004138588.1| PREDICTED: origin recognition complex subunit 5-like [Cucumis sativus] Length = 536 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 379 SRYRSTVSEEMALKVARSVNFPLSKYLYRR 290 +RYRSTVSE+MALKVARS+ FPLSKY+YRR Sbjct: 507 TRYRSTVSEDMALKVARSIKFPLSKYMYRR 536