BLASTX nr result
ID: Aconitum21_contig00020388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00020388 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518645.1| Thioredoxin domain-containing protein, putat... 75 4e-12 ref|XP_002300249.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_002313888.1| predicted protein [Populus trichocarpa] gi|1... 75 6e-12 ref|XP_003573612.1| PREDICTED: thioredoxin domain-containing pro... 74 1e-11 ref|XP_004151883.1| PREDICTED: thioredoxin domain-containing pro... 74 1e-11 >ref|XP_002518645.1| Thioredoxin domain-containing protein, putative [Ricinus communis] gi|223542026|gb|EEF43570.1| Thioredoxin domain-containing protein, putative [Ricinus communis] Length = 209 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 522 HIETRFVKIHAEKSPFFAKKLKILVLPTLTLVKNAKVEDYVV 397 HIETRFVKIHAEKSPF A++LKI+VLPTL L+KNAKV+DYVV Sbjct: 113 HIETRFVKIHAEKSPFLAERLKIVVLPTLALIKNAKVDDYVV 154 >ref|XP_002300249.1| predicted protein [Populus trichocarpa] gi|222847507|gb|EEE85054.1| predicted protein [Populus trichocarpa] Length = 212 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 522 HIETRFVKIHAEKSPFFAKKLKILVLPTLTLVKNAKVEDYVV 397 HIETRFVKIHAEKSPF A+KLKI+VLPTL L+KN KV+DYVV Sbjct: 113 HIETRFVKIHAEKSPFLAEKLKIVVLPTLALIKNTKVDDYVV 154 >ref|XP_002313888.1| predicted protein [Populus trichocarpa] gi|118484130|gb|ABK93948.1| unknown [Populus trichocarpa] gi|222850296|gb|EEE87843.1| predicted protein [Populus trichocarpa] Length = 213 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 522 HIETRFVKIHAEKSPFFAKKLKILVLPTLTLVKNAKVEDYVV 397 HIETRFVKI+AEKSPF A+KLKILVLPTL L+KNAKV+DYVV Sbjct: 113 HIETRFVKINAEKSPFLAEKLKILVLPTLALIKNAKVDDYVV 154 >ref|XP_003573612.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Brachypodium distachyon] Length = 211 Score = 74.3 bits (181), Expect = 1e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -3 Query: 522 HIETRFVKIHAEKSPFFAKKLKILVLPTLTLVKNAKVEDYVV 397 H+ETRF+K+HAEKSPF +KL+I+VLPTL LVKNAKVEDYVV Sbjct: 111 HVETRFIKVHAEKSPFLTEKLRIVVLPTLALVKNAKVEDYVV 152 >ref|XP_004151883.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis sativus] gi|449526443|ref|XP_004170223.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis sativus] Length = 213 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 522 HIETRFVKIHAEKSPFFAKKLKILVLPTLTLVKNAKVEDYVV 397 HIETRFVKI+AEKSPF A+KLKI+VLPTL L+KNAKV+DYVV Sbjct: 113 HIETRFVKINAEKSPFLAEKLKIVVLPTLALIKNAKVDDYVV 154