BLASTX nr result
ID: Aconitum21_contig00019809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00019809 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65498.1| hypothetical protein VITISV_028324 [Vitis vinifera] 52 2e-06 emb|CAN78985.1| hypothetical protein VITISV_038307 [Vitis vinifera] 52 4e-06 ref|XP_002284948.2| PREDICTED: 39S ribosomal protein L45, mitoch... 52 4e-06 emb|CAN63016.1| hypothetical protein VITISV_017409 [Vitis vinifera] 52 6e-06 >emb|CAN65498.1| hypothetical protein VITISV_028324 [Vitis vinifera] Length = 572 Score = 52.4 bits (124), Expect(2) = 2e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -3 Query: 260 FGVRSNAFWRRIIQATYGEKQFGWVMNKVPRSYGTGLWKGI 138 F + +FWRR+I YGE Q GW +V SYGTGLWK I Sbjct: 245 FPIERESFWRRVIVGKYGEVQGGWTTREVRESYGTGLWKVI 285 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 333 KQVGGLGIRSINDFN 289 K+ GGLG+R + DFN Sbjct: 220 KRHGGLGLRYLKDFN 234 >emb|CAN78985.1| hypothetical protein VITISV_038307 [Vitis vinifera] Length = 489 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -3 Query: 260 FGVRSNAFWRRIIQATYGEKQFGWVMNKVPRSYGTGLWKGI 138 F + +FWRR+I +GE Q GW +V SYGTGLWK I Sbjct: 44 FPIERESFWRRVIVGKFGEVQGGWTTREVRESYGTGLWKDI 84 Score = 23.9 bits (50), Expect(2) = 4e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 333 KQVGGLGIRSINDFN 289 K+ GGLG+R + DFN Sbjct: 19 KRHGGLGLRYLKDFN 33 >ref|XP_002284948.2| PREDICTED: 39S ribosomal protein L45, mitochondrial-like [Vitis vinifera] Length = 379 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -3 Query: 260 FGVRSNAFWRRIIQATYGEKQFGWVMNKVPRSYGTGLWKGI 138 F + +FWRR+I +GE Q GW +V SYGTGLWK I Sbjct: 44 FPIERESFWRRVIVGKFGEVQGGWTTREVRESYGTGLWKDI 84 Score = 23.9 bits (50), Expect(2) = 4e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 333 KQVGGLGIRSINDFN 289 K+ GGLG+R + DFN Sbjct: 19 KRHGGLGLRYLKDFN 33 >emb|CAN63016.1| hypothetical protein VITISV_017409 [Vitis vinifera] Length = 873 Score = 51.6 bits (122), Expect(2) = 6e-06 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -3 Query: 260 FGVRSNAFWRRIIQATYGEKQFGWVMNKVPRSYGTGLWKGI 138 F + +FWRR+I +GE Q GW +V SYGTGLWK I Sbjct: 565 FPIERESFWRRVIVGKFGEVQGGWTTREVRESYGTGLWKDI 605 Score = 23.1 bits (48), Expect(2) = 6e-06 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -2 Query: 420 FTWGYH*GLDPRYMSHSLRRSGISFW-ILLKQV--GGLGIRSINDFN 289 F WG ++ R H +R W ++ K + GGLG+R + DFN Sbjct: 517 FLWG---DMEERRKIHLVR------WEVICKDMRHGGLGLRYLKDFN 554